Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3537
Gene name
LocationContig_193:20544..23643
Strand+
Gene length (bp)3099
Transcript length (bp)2688
Coding sequence length (bp)2688
Protein length (aa) 896

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6181 0.8329 0.0668 0.0523 0.0345 0.0019 0.0362 0.0486 0.036 0.0018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2461
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1332
Ophiocordyceps australis map64 (Brazil) OphauB2|6007
Ophiocordyceps camponoti-floridani Ophcf2|06794
Ophiocordyceps camponoti-rufipedis Ophun1|5903
Ophiocordyceps kimflemingae Ophio5|5729
Ophiocordyceps subramaniannii Hirsu2|3537 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3537
MAASQEPGEDEISQVIDFANLNPEDDRSMVIQALKDNGGNVESVVMQYFDNPATFRQKFARLWNESMFSADRDGS
DNQTGISFHIESMGQNDVILGVTPPPERGGPGAPSRPPSRSNTRSPLGAMVDWTAGGDTAGGSSTHSKEDQDMQR
ALRESAQEAGIALPHQESGVLDPTTSMPYFGPANRNEYDQDSWAMVPSESKVAAAPTPEMRRRAPGAPAFLVQGV
SSAGQHCLGGLLTILHEIPLSRNLLLFSGVPAESYGYNSEWWKGQEILAPQVLAKLQSGEIQWGERHGVSPNFEE
EIHRLMAFLDSTERSYGAVSVLTDLIPFSSVGPEKRLFEHLIQQQAALMMPLTQVATLSQVLSDEEGEEEARFGL
LEIEHPRVDYVNIKTLYESLDHVMWSDVLSWGEIHEGSNMAMFKNMGDVFIMKISGDGPQDSIEIPQVLYPEKYL
VSRKDEARRIQRGWCETKRAMHGVAQSEQELFEWKNDWNSQMGDKREMLRRVVGQWEAYREYLETRGRFRGMEES
GFDTDRYPDYRAAPCKMDGEESAHHRVVQDVLVLAEEALADIDNKLEALNKNMEQIRSKQRFLGNLLTEPEKPGR
PKPMTCKKYLLRGVATPNDVVYLCQRSEADSSELEGGSPPYDQWWRLAYSPKDDQPVEAEKIEIERVFRDVWQET
KTPLFVYATESALNTARAPLPAPLERFVRAENKAFRQELGREQADGAPAADVRGTLTMEAISPSKRKHRADSADS
MDSNRASLGSDDRNGFDDDPFLEDGPVTATEMADLSDRRRVAAPNQQSNGGAEPATAEGGGATAPLPNRQARETD
RTRDGVLAERGASAAAHESPSPNEEAEAPARAPEMQERARPLTFMAASASKSQSNGQANTIDMELPDYQE*
Coding >Hirsu2|3537
ATGGCCGCCTCCCAGGAGCCCGGGGAGGACGAGATTTCGCAGGTCATCGACTTTGCCAATCTCAACCCCGAAGAC
GATCGCTCCATGGTCATTCAGGCGCTCAAGGACAACGGTGGAAATGTCGAATCGGTCGTCATGCAATACTTCGAT
AACCCCGCGACCTTTCGGCAAAAGTTTGCGCGGCTATGGAACGAAAGCATGTTCTCTGCCGACCGAGACGGCTCC
GATAATCAGACTGGAATCTCGTTCCACATAGAATCTATGGGACAGAACGATGTCATCCTGGGAGTCACACCGCCC
CCGGAAAGGGGCGGGCCGGGTGCCCCCTCACGGCCGCCGTCGAGATCCAACACTCGCTCGCCCCTCGGTGCAATG
GTGGATTGGACCGCGGGAGGAGACACGGCCGGTGGCTCGAGTACGCATTCCAAGGAGGACCAGGACATGCAACGA
GCTTTACGGGAGTCGGCCCAAGAGGCTGGCATCGCTCTACCCCATCAGGAATCCGGCGTTCTGGATCCGACGACG
TCGATGCCATACTTTGGCCCCGCTAACCGCAACGAGTACGACCAGGACAGCTGGGCCATGGTCCCGTCCGAGTCC
AAAGTGGCTGCCGCGCCCACGCCGGAGATGAGGAGGAGAGCTCCGGGTGCGCCCGCCTTTCTCGTTCAGGGGGTC
AGCTCGGCCGGCCAGCATTGCCTCGGCGGGCTGCTGACCATTCTGCACGAGATTCCCCTTTCGCGCAACCTCCTG
CTGTTCTCCGGCGTGCCCGCCGAATCGTACGGCTACAACAGCGAGTGGTGGAAGGGCCAGGAAATCCTTGCACCC
CAGGTTCTAGCCAAGCTGCAGAGCGGCGAGATACAGTGGGGCGAGCGCCACGGGGTGTCGCCCAATTTCGAGGAG
GAGATCCATCGGCTCATGGCCTTCCTCGACTCGACCGAGCGCAGCTACGGCGCCGTGAGCGTGCTGACAGACCTC
ATTCCCTTCTCCAGCGTCGGCCCCGAGAAGCGCCTCTTTGAGCATCTCATCCAGCAGCAGGCCGCGCTGATGATG
CCGCTGACGCAGGTGGCCACTCTGTCCCAGGTGCTGAGCGATGAGGAGGGCGAGGAGGAGGCCAGGTTCGGCCTC
CTGGAGATCGAACATCCGCGAGTGGACTACGTCAACATCAAGACGCTGTACGAGTCCCTGGACCACGTCATGTGG
AGCGACGTGCTGTCCTGGGGCGAGATACATGAGGGGTCCAACATGGCCATGTTCAAGAACATGGGCGACGTCTTC
ATCATGAAGATATCGGGCGACGGGCCTCAAGATTCCATCGAGATACCCCAGGTGCTGTATCCGGAGAAGTACCTC
GTGAGCCGGAAAGACGAAGCGCGTCGGATCCAACGAGGTTGGTGCGAGACGAAGAGGGCCATGCATGGCGTGGCG
CAGAGCGAGCAAGAGCTCTTTGAGTGGAAGAACGACTGGAACAGCCAAATGGGAGACAAGCGAGAAATGCTGCGC
AGGGTCGTGGGCCAGTGGGAGGCCTATCGCGAATACCTGGAGACGCGCGGGCGCTTCCGGGGCATGGAGGAGTCG
GGTTTCGACACGGACAGGTATCCGGACTACCGAGCAGCACCCTGCAAAATGGACGGCGAGGAATCGGCGCACCAC
CGCGTGGTCCAGGACGTACTCGTGCTGGCAGAAGAAGCTCTGGCGGATATTGACAACAAATTGGAAGCGCTCAAC
AAGAACATGGAGCAAATCAGGAGCAAGCAGCGTTTCCTGGGAAACCTGCTCACGGAGCCCGAGAAGCCCGGCCGA
CCAAAGCCCATGACGTGCAAAAAATACCTCCTTCGCGGCGTCGCGACGCCCAATGACGTCGTCTATCTGTGCCAG
CGCTCAGAGGCGGACAGCAGCGAACTGGAAGGCGGATCGCCGCCGTATGATCAGTGGTGGAGGCTCGCATACTCG
CCCAAGGATGATCAGCCAGTCGAGGCAGAGAAAATCGAGATTGAGCGCGTGTTCCGCGACGTCTGGCAAGAAACC
AAAACGCCTCTGTTCGTGTACGCGACCGAGAGTGCGCTCAACACGGCACGAGCGCCGTTGCCCGCGCCGCTAGAA
CGCTTTGTCCGGGCAGAAAATAAGGCCTTCCGCCAGGAACTCGGCCGGGAGCAGGCCGACGGGGCGCCGGCGGCA
GACGTGCGAGGGACGCTGACGATGGAGGCCATATCCCCCTCGAAGCGGAAGCATCGAGCGGACAGCGCGGATTCC
ATGGACAGCAACCGTGCGTCGCTCGGGAGTGACGACCGCAACGGCTTCGACGACGATCCCTTTCTCGAAGATGGC
CCCGTCACGGCGACGGAAATGGCGGACCTGTCGGACCGACGGCGCGTGGCAGCGCCGAACCAGCAGAGTAACGGT
GGCGCGGAGCCAGCAACAGCAGAGGGCGGCGGAGCGACGGCGCCGCTGCCGAATCGACAGGCAAGGGAAACGGAC
AGGACAAGAGACGGCGTGCTTGCCGAGCGAGGGGCGTCGGCGGCGGCCCACGAGAGTCCGTCACCGAACGAAGAG
GCCGAGGCGCCGGCACGGGCTCCCGAAATGCAGGAACGAGCTCGGCCACTGACGTTCATGGCGGCATCAGCCAGC
AAATCGCAGTCGAACGGGCAAGCCAACACAATAGACATGGAACTCCCAGACTACCAGGAATAG
Transcript >Hirsu2|3537
ATGGCCGCCTCCCAGGAGCCCGGGGAGGACGAGATTTCGCAGGTCATCGACTTTGCCAATCTCAACCCCGAAGAC
GATCGCTCCATGGTCATTCAGGCGCTCAAGGACAACGGTGGAAATGTCGAATCGGTCGTCATGCAATACTTCGAT
AACCCCGCGACCTTTCGGCAAAAGTTTGCGCGGCTATGGAACGAAAGCATGTTCTCTGCCGACCGAGACGGCTCC
GATAATCAGACTGGAATCTCGTTCCACATAGAATCTATGGGACAGAACGATGTCATCCTGGGAGTCACACCGCCC
CCGGAAAGGGGCGGGCCGGGTGCCCCCTCACGGCCGCCGTCGAGATCCAACACTCGCTCGCCCCTCGGTGCAATG
GTGGATTGGACCGCGGGAGGAGACACGGCCGGTGGCTCGAGTACGCATTCCAAGGAGGACCAGGACATGCAACGA
GCTTTACGGGAGTCGGCCCAAGAGGCTGGCATCGCTCTACCCCATCAGGAATCCGGCGTTCTGGATCCGACGACG
TCGATGCCATACTTTGGCCCCGCTAACCGCAACGAGTACGACCAGGACAGCTGGGCCATGGTCCCGTCCGAGTCC
AAAGTGGCTGCCGCGCCCACGCCGGAGATGAGGAGGAGAGCTCCGGGTGCGCCCGCCTTTCTCGTTCAGGGGGTC
AGCTCGGCCGGCCAGCATTGCCTCGGCGGGCTGCTGACCATTCTGCACGAGATTCCCCTTTCGCGCAACCTCCTG
CTGTTCTCCGGCGTGCCCGCCGAATCGTACGGCTACAACAGCGAGTGGTGGAAGGGCCAGGAAATCCTTGCACCC
CAGGTTCTAGCCAAGCTGCAGAGCGGCGAGATACAGTGGGGCGAGCGCCACGGGGTGTCGCCCAATTTCGAGGAG
GAGATCCATCGGCTCATGGCCTTCCTCGACTCGACCGAGCGCAGCTACGGCGCCGTGAGCGTGCTGACAGACCTC
ATTCCCTTCTCCAGCGTCGGCCCCGAGAAGCGCCTCTTTGAGCATCTCATCCAGCAGCAGGCCGCGCTGATGATG
CCGCTGACGCAGGTGGCCACTCTGTCCCAGGTGCTGAGCGATGAGGAGGGCGAGGAGGAGGCCAGGTTCGGCCTC
CTGGAGATCGAACATCCGCGAGTGGACTACGTCAACATCAAGACGCTGTACGAGTCCCTGGACCACGTCATGTGG
AGCGACGTGCTGTCCTGGGGCGAGATACATGAGGGGTCCAACATGGCCATGTTCAAGAACATGGGCGACGTCTTC
ATCATGAAGATATCGGGCGACGGGCCTCAAGATTCCATCGAGATACCCCAGGTGCTGTATCCGGAGAAGTACCTC
GTGAGCCGGAAAGACGAAGCGCGTCGGATCCAACGAGGTTGGTGCGAGACGAAGAGGGCCATGCATGGCGTGGCG
CAGAGCGAGCAAGAGCTCTTTGAGTGGAAGAACGACTGGAACAGCCAAATGGGAGACAAGCGAGAAATGCTGCGC
AGGGTCGTGGGCCAGTGGGAGGCCTATCGCGAATACCTGGAGACGCGCGGGCGCTTCCGGGGCATGGAGGAGTCG
GGTTTCGACACGGACAGGTATCCGGACTACCGAGCAGCACCCTGCAAAATGGACGGCGAGGAATCGGCGCACCAC
CGCGTGGTCCAGGACGTACTCGTGCTGGCAGAAGAAGCTCTGGCGGATATTGACAACAAATTGGAAGCGCTCAAC
AAGAACATGGAGCAAATCAGGAGCAAGCAGCGTTTCCTGGGAAACCTGCTCACGGAGCCCGAGAAGCCCGGCCGA
CCAAAGCCCATGACGTGCAAAAAATACCTCCTTCGCGGCGTCGCGACGCCCAATGACGTCGTCTATCTGTGCCAG
CGCTCAGAGGCGGACAGCAGCGAACTGGAAGGCGGATCGCCGCCGTATGATCAGTGGTGGAGGCTCGCATACTCG
CCCAAGGATGATCAGCCAGTCGAGGCAGAGAAAATCGAGATTGAGCGCGTGTTCCGCGACGTCTGGCAAGAAACC
AAAACGCCTCTGTTCGTGTACGCGACCGAGAGTGCGCTCAACACGGCACGAGCGCCGTTGCCCGCGCCGCTAGAA
CGCTTTGTCCGGGCAGAAAATAAGGCCTTCCGCCAGGAACTCGGCCGGGAGCAGGCCGACGGGGCGCCGGCGGCA
GACGTGCGAGGGACGCTGACGATGGAGGCCATATCCCCCTCGAAGCGGAAGCATCGAGCGGACAGCGCGGATTCC
ATGGACAGCAACCGTGCGTCGCTCGGGAGTGACGACCGCAACGGCTTCGACGACGATCCCTTTCTCGAAGATGGC
CCCGTCACGGCGACGGAAATGGCGGACCTGTCGGACCGACGGCGCGTGGCAGCGCCGAACCAGCAGAGTAACGGT
GGCGCGGAGCCAGCAACAGCAGAGGGCGGCGGAGCGACGGCGCCGCTGCCGAATCGACAGGCAAGGGAAACGGAC
AGGACAAGAGACGGCGTGCTTGCCGAGCGAGGGGCGTCGGCGGCGGCCCACGAGAGTCCGTCACCGAACGAAGAG
GCCGAGGCGCCGGCACGGGCTCCCGAAATGCAGGAACGAGCTCGGCCACTGACGTTCATGGCGGCATCAGCCAGC
AAATCGCAGTCGAACGGGCAAGCCAACACAATAGACATGGAACTCCCAGACTACCAGGAATAG
Gene >Hirsu2|3537
ATGGCCGCCTCCCAGGAGCCCGGGGAGGACGAGATTTCGCAGGTCATCGACTTTGCCAATCTCAACCCCGAAGAC
GATCGCTCCATGGTCATTCAGGCGCTCAAGGTATCATACCCTTTGTTCTCCCTCACCCCGTGTTCTGGATCGCGA
CTGACGCCGGCGCGGCCTGCAGGACAACGGTGGAAATGTCGAATCGGTCGTCATGCAATACTTCGATAACCCCGC
GACCGTATGGACGCCCCAACCCGAACGAGCCTCGCCGTGGCGCCTGATGGCTAACTTGGCCACAGTTTCGGCAAA
AGTTTGCGCGGCTATGGAACGAAAGCATGTTCTCTGCCGACCGAGACGGCTCCGATAATCAGACTGGAATCTGTG
AGCTCGGCCGCAGGGGGCACCTTCGCAAAGCACGAGCAGTCGGCTGACCGGCATAGCGTTCCACATAGAATCTAT
GGGACAGAACGATGTCATCCTGGGAGTCACACCGCCCCCGGAAAGGGGCGGGCCGGGTGCCCCCTCACGGCCGCC
GTCGAGATCCAACACTCGCTCGCCCCTCGGTGCAATGGTGGATTGGACCGCGGGAGGAGACACGGCCGGTACTGC
TCGCCTGCCCTCTTCCGTGATAATGGGCGCAGACTGATGAGCGTGCGTCTCAGGTGGCTCGAGTACGCATTCCAA
GGAGGACCAGGACATGCAACGAGCTTTACGGGAGTCGGCCCAAGAGGCTGGCATCGCTCTACCCCATCAGGAATC
CGGCGTTCTGGATCCGACGACGTCGATGCCATACTTTGGCCCCGCTAACCGCAACGAGTACGACCAGGACAGCTG
GGCCATGGTCCCGTCCGAGTCCAAAGTGGCTGCCGCGCCCACGCCGGAGATGAGGAGGAGAGCTCCGGGTGCGCC
CGCCTTTCTCGTTCAGGGGGTCAGCTCGGCCGGCCAGCATTGCCTCGGCGGGCTGCTGACCATTCTGCACGAGAT
TCCCCTTTCGCGCAACCTCCTGCTGTTCTCCGGCGTGCCCGCCGAATCGTACGGCTACAACAGCGAGTGGTGGAA
GGGCCAGGAAATCCTTGCACCCCAGGTTCTAGCCAAGCTGCAGAGCGGCGAGATACAGTGGGGCGAGCGCCACGG
GGTGTCGCCCAATTTCGAGGAGGAGATCCATCGGCTCATGGCCTTCCTCGACTCGACCGAGCGCAGCTACGGCGC
CGTGAGCGTGCTGACAGACCTCATTCCCTTCTCCAGCGTCGGCCCCGAGAAGCGCCTCTTTGAGCATCTCATCCA
GCAGCAGGCCGCGCTGATGATGCCGCTGACGCAGGTGGCCACTCTGTCCCAGGTGCTGAGCGATGAGGAGGGCGA
GGAGGAGGCCAGGTTCGGCCTCCTGGAGATCGAACATCCGCGAGTGGACTACGTCAACATCAAGACGCTGTACGA
GTCCCTGGACCACGTCATGTGGAGCGACGTGCTGTCCTGGGGCGAGATACATGAGGGGTCCAACATGGCCATGTT
CAAGAACATGGGCGACGTCTTCATCATGAAGATATCGGGCGACGGGCCTCAAGATTCCATCGAGATACCCCAGGT
GCTGTATCCGGAGAAGTACCTCGTGAGCCGGAAAGACGAAGCGCGTCGGATCCAACGAGGTTGGTGCGAGACGAA
GAGGGCCATGCATGGCGTGGCGCAGAGCGAGCAAGAGCTCTTTGAGTGGAAGAACGACTGGAACAGCCAAATGGG
AGACAAGCGAGAAATGCTGCGCAGGGTCGTGGGCCAGTGGGAGGCCTATCGCGAATACCTGGAGACGCGCGGGCG
CTTCCGGGGCATGGAGGAGTCGGGTTTCGACACGGACAGGTATCCGGACTACCGAGCAGCACCCTGCAAAATGGA
CGGCGAGGAATCGGCGCACCACCGCGTGGTCCAGGACGTACTCGTGCTGGCAGAAGAAGCTCTGGCGGATATTGA
CAACAAATTGGAAGGTGAGTGAGCCCGTTTCAACGGCCCGCACGTGCGAGCCCTCGGGCAAGAGCCTCCTAACTC
GGGCACAGCGCTCAACAAGAACATGGAGCAAATCAGGAGCAAGCAGCGTTTCCTGGGAAACCTGCTCACGGAGCC
CGAGAAGCCCGGCCGACCAAAGCCCATGACGTGCAAAAAATACCTCCTTCGCGGCGTCGCGACGCCCAATGACGT
CGTCTATCTGTGCCAGCGCTCAGAGGCGGACAGCAGCGAACTGGAAGGCGGATCGCCGCCGTATGATCAGTGGTG
GAGGCTCGCATACTCGCCCAAGGATGATCAGCCAGTCGAGGCAGAGGTAAGCAGTGGCTCTTGCATATCGCTCCC
CCGGGCCCTACTCTTGTCCGGATACGTCGCGGCCGGCCACAACCGAAGGCTGACGCGTGGAGCAAGAAAATCGAG
ATTGAGCGCGTGTTCCGCGACGTCTGGCAAGAAACCAAAACGCCTCTGTTCGTGTACGCGACCGAGAGTGCGCTC
AACACGGCACGAGCGCCGTTGCCCGCGCCGCTAGAACGCTTTGTCCGGGCAGAAAATAAGGCCTTCCGCCAGGAA
CTCGGCCGGGAGCAGGCCGACGGGGCGCCGGCGGCAGACGTGCGAGGGACGCTGACGATGGAGGCCATATCCCCC
TCGAAGCGGAAGCATCGAGCGGACAGCGCGGATTCCATGGACAGCAACCGTGCGTCGCTCGGGAGTGACGACCGC
AACGGCTTCGACGACGATCCCTTTCTCGAAGATGGCCCCGTCACGGCGACGGAAATGGCGGACCTGTCGGACCGA
CGGCGCGTGGCAGCGCCGAACCAGCAGAGTAACGGTGGCGCGGAGCCAGCAACAGCAGAGGGCGGCGGAGCGACG
GCGCCGCTGCCGAATCGACAGGCAAGGGAAACGGACAGGACAAGAGACGGCGTGCTTGCCGAGCGAGGGGCGTCG
GCGGCGGCCCACGAGAGTCCGTCACCGAACGAAGAGGCCGAGGCGCCGGCACGGGCTCCCGAAATGCAGGAACGA
GCTCGGCCACTGACGTTCATGGCGGCATCAGCCAGCAAATCGCAGTCGAACGGGCAAGCCAACACAATAGACATG
GAACTCCCAGACTACCAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail