Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3535
Gene name
LocationContig_193:11639..16771
Strand+
Gene length (bp)5132
Transcript length (bp)4818
Coding sequence length (bp)4818
Protein length (aa) 1606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.4E-25 277 546
PF00069 Pkinase Protein kinase domain 5.8E-12 597 662
PF00069 Pkinase Protein kinase domain 4.0E-37 769 962
PF12745 HGTP_anticodon2 Anticodon binding domain of tRNAs 8.8E-78 1363 1603
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.8E-16 318 536
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.1E-05 600 663
PF07714 Pkinase_Tyr Protein tyrosine kinase 5.5E-21 770 961
PF13393 tRNA-synt_His Histidyl-tRNA synthetase 1.1E-17 1056 1337
PF05773 RWD RWD domain 1.1E-11 42 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 39 1603 0.0E+00
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 41 1603 0.0E+00
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 590 1594 3.0E-97
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 770 1440 6.0E-72
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 770 1463 1.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 39 1603 0.0E+00
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 41 1603 0.0E+00
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 590 1594 3.0E-97
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 770 1440 6.0E-72
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 770 1463 1.0E-71
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 590 1337 2.0E-54
sp|D0Z5N4|E2AKB_CAEEL Eukaryotic translation initiation factor 2-alpha kinase gcn-2 OS=Caenorhabditis elegans GN=gcn-2 PE=1 SV=2 769 1541 4.0E-46
sp|Q4R8E0|E2AK1_MACFA Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Macaca fascicularis GN=EIF2AK1 PE=2 SV=1 577 963 4.0E-43
sp|Q63185|E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus GN=Eif2ak1 PE=1 SV=2 574 963 8.0E-40
sp|Q9UTE5|E2AK2_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri2 PE=1 SV=1 590 980 2.0E-39
sp|P33279|E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus GN=EIF2AK1 PE=1 SV=1 577 963 4.0E-39
sp|O13889|E2AK1_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hri1 PE=1 SV=1 590 964 2.0E-38
sp|Q9BQI3|E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens GN=EIF2AK1 PE=1 SV=2 766 963 4.0E-24
sp|Q9Z2R9|E2AK1_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Mus musculus GN=Eif2ak1 PE=1 SV=2 766 963 4.0E-22
sp|Q9NIV1|E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster GN=PEK PE=1 SV=2 764 960 5.0E-22
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 769 963 4.0E-21
sp|Q9Z2B5|E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus GN=Eif2ak3 PE=1 SV=1 767 964 1.0E-20
sp|Q9Z1Z1|E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus GN=Eif2ak3 PE=1 SV=1 767 964 1.0E-20
sp|Q75JN1|IFKC_DICDI Probable serine/threonine-protein kinase ifkC OS=Dictyostelium discoideum GN=ifkC PE=3 SV=1 867 1000 5.0E-20
sp|Q86AS6|SYHC_DICDI Histidine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=hisS PE=3 SV=1 1018 1433 1.0E-19
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 769 963 3.0E-19
sp|Q9NZJ5|E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 767 964 4.0E-19
sp|F4IYF8|SYHC_ARATH Histidine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g02760 PE=2 SV=1 1027 1427 3.0E-18
sp|Q75JN1|IFKC_DICDI Probable serine/threonine-protein kinase ifkC OS=Dictyostelium discoideum GN=ifkC PE=3 SV=1 770 885 1.0E-17
sp|Q99KK9|SYHM_MOUSE Probable histidine--tRNA ligase, mitochondrial OS=Mus musculus GN=Hars2 PE=1 SV=1 1018 1337 3.0E-17
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 768 1027 5.0E-17
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 769 963 6.0E-17
sp|P93422|SYHC_ORYSJ Histidine--tRNA ligase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os05g0150900 PE=2 SV=2 1032 1442 6.0E-17
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 768 961 7.0E-17
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 770 975 8.0E-17
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 768 976 8.0E-17
sp|Q19192|E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans GN=pek-1 PE=1 SV=2 694 960 1.0E-16
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 750 983 1.0E-16
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 770 968 2.0E-16
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 756 1040 2.0E-16
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 770 954 2.0E-16
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 770 954 2.0E-16
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 770 976 3.0E-16
sp|Q75JN1|IFKC_DICDI Probable serine/threonine-protein kinase ifkC OS=Dictyostelium discoideum GN=ifkC PE=3 SV=1 590 670 5.0E-16
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 770 962 5.0E-16
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 767 966 6.0E-16
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 772 1001 7.0E-16
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 769 959 7.0E-16
sp|Q55F45|Y8642_DICDI Probable serine/threonine-protein kinase DDB_G0268642 OS=Dictyostelium discoideum GN=DDB_G0268642 PE=3 SV=1 770 846 8.0E-16
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 770 966 8.0E-16
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 766 952 9.0E-16
sp|Q54RP7|Y0652_DICDI Probable serine/threonine-protein kinase DDB_G0283065 OS=Dictyostelium discoideum GN=DDB_G0283065 PE=3 SV=1 770 931 1.0E-15
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 770 962 1.0E-15
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 772 962 1.0E-15
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 770 970 3.0E-15
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 770 1040 3.0E-15
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 772 984 4.0E-15
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 760 980 5.0E-15
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 770 978 6.0E-15
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 770 962 6.0E-15
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 760 961 7.0E-15
sp|P84390|US03_EHV1V Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain V592) GN=69 PE=3 SV=1 802 955 7.0E-15
sp|P28926|US03_EHV1B Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain Ab4p) GN=69 PE=3 SV=1 802 955 7.0E-15
sp|P32516|KR1_EHV1K Serine/threonine-protein kinase OS=Equine herpesvirus 1 (strain Kentucky A) GN=US2 PE=3 SV=1 802 955 7.0E-15
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 770 961 7.0E-15
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 770 970 9.0E-15
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 761 962 1.0E-14
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 770 962 1.0E-14
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 770 904 1.0E-14
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 770 904 1.0E-14
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 760 966 1.0E-14
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 770 904 1.0E-14
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 770 964 1.0E-14
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 770 904 1.0E-14
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 799 904 1.0E-14
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 770 960 1.0E-14
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 762 961 1.0E-14
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 770 961 1.0E-14
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 771 962 1.0E-14
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 766 905 1.0E-14
sp|Q9BQI3|E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens GN=EIF2AK1 PE=1 SV=2 577 664 2.0E-14
sp|Q9Z2R9|E2AK1_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Mus musculus GN=Eif2ak1 PE=1 SV=2 574 664 2.0E-14
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 800 936 2.0E-14
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 800 936 2.0E-14
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 770 998 2.0E-14
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 800 936 2.0E-14
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 800 936 2.0E-14
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 770 960 2.0E-14
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 743 904 2.0E-14
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 770 998 2.0E-14
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 762 966 2.0E-14
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 762 908 2.0E-14
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 770 979 2.0E-14
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 770 904 2.0E-14
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 770 966 2.0E-14
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 771 998 2.0E-14
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 770 998 2.0E-14
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 770 958 2.0E-14
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 770 998 2.0E-14
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 771 998 2.0E-14
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 770 962 2.0E-14
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 770 961 3.0E-14
sp|A3EZ53|HOG1_WALMU Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia muriae GN=HOG1 PE=3 SV=1 803 966 3.0E-14
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 770 961 3.0E-14
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 770 962 3.0E-14
sp|P47355|PKNS_MYCGE Putative serine/threonine-protein kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG109 PE=3 SV=2 769 904 3.0E-14
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 769 904 3.0E-14
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 768 904 3.0E-14
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 790 962 3.0E-14
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 770 966 3.0E-14
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 772 979 4.0E-14
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 770 961 4.0E-14
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 772 979 4.0E-14
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 740 904 4.0E-14
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 740 904 4.0E-14
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 762 902 4.0E-14
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 768 905 5.0E-14
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 760 966 5.0E-14
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 770 904 5.0E-14
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 770 904 5.0E-14
sp|Q8QZR7|PDK1L_MOUSE Serine/threonine-protein kinase PDIK1L OS=Mus musculus GN=Pdik1l PE=2 SV=1 770 960 5.0E-14
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 770 961 5.0E-14
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 770 961 5.0E-14
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 771 998 5.0E-14
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 770 961 6.0E-14
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 770 961 6.0E-14
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 770 962 6.0E-14
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 762 961 6.0E-14
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 772 984 6.0E-14
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 769 997 6.0E-14
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 770 961 6.0E-14
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 769 962 7.0E-14
sp|A3EZ54|HOG1_WALSE Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia sebi GN=HOG1 PE=3 SV=1 803 966 7.0E-14
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 769 962 7.0E-14
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 770 966 7.0E-14
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1 590 666 8.0E-14
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 771 907 8.0E-14
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 768 962 8.0E-14
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 769 905 8.0E-14
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 766 905 8.0E-14
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 767 961 9.0E-14
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 797 962 9.0E-14
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 769 961 9.0E-14
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 770 962 1.0E-13
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 772 966 1.0E-13
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 767 961 1.0E-13
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 771 904 1.0E-13
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 771 998 1.0E-13
sp|Q8N165|PDK1L_HUMAN Serine/threonine-protein kinase PDIK1L OS=Homo sapiens GN=PDIK1L PE=1 SV=1 770 960 1.0E-13
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 770 961 1.0E-13
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 755 998 1.0E-13
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 770 961 1.0E-13
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 762 961 1.0E-13
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 762 966 1.0E-13
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 762 966 1.0E-13
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 768 963 1.0E-13
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 770 932 1.0E-13
sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 770 966 1.0E-13
sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 770 966 1.0E-13
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 793 962 1.0E-13
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 770 966 1.0E-13
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 767 963 1.0E-13
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 800 961 1.0E-13
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 799 962 1.0E-13
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 797 958 1.0E-13
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 767 990 2.0E-13
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 797 955 2.0E-13
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 762 966 2.0E-13
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 771 998 2.0E-13
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 771 998 2.0E-13
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 797 958 2.0E-13
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 770 961 2.0E-13
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 770 962 2.0E-13
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 770 966 2.0E-13
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 770 962 2.0E-13
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 770 905 2.0E-13
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 803 994 2.0E-13
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 762 961 2.0E-13
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 772 962 2.0E-13
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 771 998 2.0E-13
sp|Q7NHH9|SYH_GLOVI Histidine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisS PE=3 SV=1 1019 1427 2.0E-13
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 770 963 2.0E-13
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 769 1002 2.0E-13
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 770 961 2.0E-13
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 762 966 2.0E-13
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 277 498 2.0E-13
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 768 966 2.0E-13
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 762 966 2.0E-13
sp|P70076|SYHC_TAKRU Histidine--tRNA ligase, cytoplasmic OS=Takifugu rubripes GN=hars PE=3 SV=1 1018 1455 2.0E-13
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 770 966 2.0E-13
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 762 902 2.0E-13
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 771 962 2.0E-13
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 770 962 2.0E-13
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 768 966 2.0E-13
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 770 926 3.0E-13
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 767 905 3.0E-13
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 799 905 3.0E-13
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 770 904 3.0E-13
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 767 963 3.0E-13
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 767 963 3.0E-13
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 762 961 3.0E-13
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 770 962 3.0E-13
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 762 961 3.0E-13
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 771 998 3.0E-13
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 770 962 3.0E-13
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 771 998 3.0E-13
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 771 998 3.0E-13
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 771 998 3.0E-13
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 762 961 3.0E-13
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 771 967 3.0E-13
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 767 962 3.0E-13
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 770 962 3.0E-13
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 766 905 3.0E-13
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 772 902 3.0E-13
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 799 962 3.0E-13
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 803 961 3.0E-13
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 770 974 3.0E-13
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 755 998 3.0E-13
sp|Q39021|MPK1_ARATH Mitogen-activated protein kinase 1 OS=Arabidopsis thaliana GN=MPK1 PE=1 SV=2 803 928 3.0E-13
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 760 904 3.0E-13
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 755 998 3.0E-13
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 799 962 3.0E-13
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 769 997 3.0E-13
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 796 984 4.0E-13
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 770 954 4.0E-13
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 762 961 4.0E-13
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 770 905 4.0E-13
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 767 963 4.0E-13
sp|Q55EI8|Y9956_DICDI Probable serine/threonine-protein kinase DDB_G0268876 OS=Dictyostelium discoideum GN=DDB_G0268876 PE=3 SV=1 770 980 4.0E-13
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 770 966 5.0E-13
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 770 962 5.0E-13
sp|Q5I6M2|HOG1_SETTU Mitogen-activated protein kinase HOG1 OS=Setosphaeria turcica GN=HOG1 PE=2 SV=2 762 954 5.0E-13
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 770 962 5.0E-13
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 769 997 5.0E-13
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 770 904 5.0E-13
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 770 962 5.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 770 904 6.0E-13
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 770 904 6.0E-13
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 786 957 6.0E-13
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 770 904 6.0E-13
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 743 933 6.0E-13
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 768 963 6.0E-13
sp|Q32PP3|PDK1L_DANRE Serine/threonine-protein kinase pdik1l OS=Danio rerio GN=pdik1l PE=2 SV=1 770 960 6.0E-13
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 770 904 6.0E-13
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 770 904 6.0E-13
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 295 498 6.0E-13
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 770 904 7.0E-13
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 770 904 7.0E-13
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 770 904 7.0E-13
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 312 546 7.0E-13
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 770 962 7.0E-13
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 760 987 7.0E-13
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 770 963 7.0E-13
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 770 962 7.0E-13
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 769 975 7.0E-13
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 770 905 8.0E-13
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 770 975 8.0E-13
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 743 904 8.0E-13
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 762 959 8.0E-13
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 770 905 8.0E-13
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 786 923 8.0E-13
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 770 904 8.0E-13
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 743 904 8.0E-13
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 766 962 8.0E-13
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 768 908 9.0E-13
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 770 1011 9.0E-13
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 762 961 9.0E-13
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 767 904 9.0E-13
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 796 962 9.0E-13
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 770 905 9.0E-13
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 770 904 9.0E-13
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 770 961 1.0E-12
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 770 961 1.0E-12
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 770 966 1.0E-12
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 770 905 1.0E-12
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 770 904 1.0E-12
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 770 904 1.0E-12
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 770 904 1.0E-12
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 768 908 1.0E-12
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 770 905 1.0E-12
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 770 905 1.0E-12
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 770 905 1.0E-12
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 770 905 1.0E-12
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 769 961 1.0E-12
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 770 904 1.0E-12
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 770 904 1.0E-12
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 770 904 1.0E-12
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 771 911 1.0E-12
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 771 911 1.0E-12
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 771 911 1.0E-12
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 766 962 1.0E-12
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 770 904 1.0E-12
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 743 904 1.0E-12
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 770 904 1.0E-12
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 801 962 1.0E-12
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 743 904 1.0E-12
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 770 961 1.0E-12
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 743 904 1.0E-12
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 762 954 1.0E-12
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 770 904 1.0E-12
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 768 908 1.0E-12
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 769 975 1.0E-12
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 762 954 1.0E-12
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 770 962 1.0E-12
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 770 961 2.0E-12
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 762 959 2.0E-12
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 774 961 2.0E-12
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 762 961 2.0E-12
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 796 928 2.0E-12
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 771 954 2.0E-12
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 769 905 2.0E-12
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 771 905 2.0E-12
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 803 953 2.0E-12
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 770 954 2.0E-12
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 771 929 2.0E-12
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 763 963 2.0E-12
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 763 963 2.0E-12
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 763 963 2.0E-12
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 772 962 2.0E-12
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 762 904 2.0E-12
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 770 904 2.0E-12
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 762 966 2.0E-12
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 764 962 2.0E-12
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 771 961 2.0E-12
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 770 961 2.0E-12
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 762 904 2.0E-12
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 770 904 2.0E-12
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 770 905 2.0E-12
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 768 962 2.0E-12
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 743 904 2.0E-12
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 770 962 2.0E-12
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 743 904 2.0E-12
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 743 904 2.0E-12
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 767 956 2.0E-12
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 771 904 2.0E-12
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 768 961 2.0E-12
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 743 904 2.0E-12
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 770 961 2.0E-12
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 768 962 2.0E-12
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 768 962 2.0E-12
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 770 904 2.0E-12
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 797 955 2.0E-12
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 772 954 2.0E-12
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 797 955 2.0E-12
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 770 904 2.0E-12
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 770 962 2.0E-12
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 312 546 3.0E-12
sp|Q1ZXR2|Y7566_DICDI Probable serine/threonine-protein kinase DDB_G0267566 OS=Dictyostelium discoideum GN=DDB_G0267566 PE=3 SV=1 762 974 3.0E-12
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 762 928 3.0E-12
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 770 962 3.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 770 962 3.0E-12
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 803 961 3.0E-12
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 762 959 3.0E-12
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 762 959 3.0E-12
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 762 959 3.0E-12
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 770 961 3.0E-12
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 770 1000 3.0E-12
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 762 966 3.0E-12
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 796 966 3.0E-12
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 770 961 3.0E-12
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 767 962 3.0E-12
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 771 998 3.0E-12
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 768 962 3.0E-12
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 770 961 3.0E-12
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 770 961 3.0E-12
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 292 548 3.0E-12
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 751 962 3.0E-12
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 770 904 3.0E-12
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 803 904 3.0E-12
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 770 977 3.0E-12
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 767 962 3.0E-12
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 797 966 3.0E-12
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 770 1000 3.0E-12
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 762 904 3.0E-12
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 752 904 3.0E-12
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 767 1027 3.0E-12
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 770 904 3.0E-12
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 770 961 4.0E-12
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 769 962 4.0E-12
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 770 917 4.0E-12
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 770 904 4.0E-12
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 770 966 4.0E-12
sp|Q4PKS0|HOG1_GIBIN Mitogen-activated protein kinase HOG1 (Fragment) OS=Gibberella intermedia GN=HOG1 PE=3 SV=1 762 904 4.0E-12
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 790 905 4.0E-12
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 770 961 4.0E-12
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 797 955 4.0E-12
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 767 904 4.0E-12
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 770 980 4.0E-12
sp|Q6E6B4|SYHC_ANTLO Probable histidine--tRNA ligase, cytoplasmic OS=Antonospora locustae PE=3 SV=1 1016 1340 4.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 768 962 4.0E-12
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 770 904 4.0E-12
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 767 962 4.0E-12
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 767 904 4.0E-12
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 770 961 4.0E-12
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 769 961 4.0E-12
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 770 917 4.0E-12
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 803 904 4.0E-12
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 770 904 4.0E-12
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 767 904 4.0E-12
sp|Q4PNJ1|HOG1_FUSCU Mitogen-activated protein kinase HOG1 (Fragment) OS=Fusarium culmorum GN=HOG1 PE=3 SV=1 762 904 4.0E-12
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 770 904 4.0E-12
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 770 904 4.0E-12
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 771 906 5.0E-12
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 768 962 5.0E-12
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 770 961 5.0E-12
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 783 904 5.0E-12
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 795 905 5.0E-12
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 768 904 5.0E-12
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 783 904 5.0E-12
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 770 904 5.0E-12
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 783 961 5.0E-12
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 772 1002 6.0E-12
sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 770 966 6.0E-12
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 768 962 6.0E-12
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 803 904 6.0E-12
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 800 961 6.0E-12
sp|P39745|MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans GN=mpk-1 PE=1 SV=2 796 904 6.0E-12
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 797 905 6.0E-12
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 800 961 6.0E-12
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 770 961 6.0E-12
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 767 961 6.0E-12
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 770 962 6.0E-12
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 770 961 6.0E-12
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 770 928 6.0E-12
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 800 966 6.0E-12
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 769 962 6.0E-12
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 375 553 7.0E-12
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 793 962 7.0E-12
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 769 921 7.0E-12
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 797 955 7.0E-12
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 762 966 7.0E-12
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 768 962 7.0E-12
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 768 908 7.0E-12
sp|Q39027|MPK7_ARATH Mitogen-activated protein kinase 7 OS=Arabidopsis thaliana GN=MPK7 PE=1 SV=2 803 904 7.0E-12
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 768 904 7.0E-12
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 770 962 8.0E-12
sp|Q40517|NTF3_TOBAC Mitogen-activated protein kinase homolog NTF3 OS=Nicotiana tabacum GN=NTF3 PE=1 SV=1 803 904 8.0E-12
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 771 961 8.0E-12
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 726 924 8.0E-12
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 770 904 8.0E-12
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 800 961 8.0E-12
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 770 962 9.0E-12
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 790 904 9.0E-12
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 767 963 9.0E-12
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 732 961 9.0E-12
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 768 905 9.0E-12
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 770 923 1.0E-11
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 803 956 1.0E-11
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 803 904 1.0E-11
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 767 954 1.0E-11
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 770 931 1.0E-11
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 762 904 1.0E-11
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 770 922 1.0E-11
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 803 952 1.0E-11
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 770 904 1.0E-11
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 328 510 1.0E-11
sp|Q54WD7|Y9719_DICDI Probable serine/threonine-protein kinase DDB_G0279719 OS=Dictyostelium discoideum GN=DDB_G0279719 PE=2 SV=1 803 966 1.0E-11
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 770 904 1.0E-11
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 770 962 1.0E-11
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 771 904 1.0E-11
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 803 904 1.0E-11
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 803 904 1.0E-11
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 768 962 1.0E-11
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 767 956 1.0E-11
sp|Q9VEZ5|IKKB_DROME Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Drosophila melanogaster GN=ird5 PE=1 SV=2 772 904 1.0E-11
sp|O23236|MPK14_ARATH Mitogen-activated protein kinase 14 OS=Arabidopsis thaliana GN=MPK14 PE=1 SV=1 803 904 1.0E-11
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 768 961 1.0E-11
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 768 911 1.0E-11
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 770 924 1.0E-11
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 767 956 1.0E-11
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 763 928 1.0E-11
sp|P24381|US03_SUHVN Serine/threonine-protein kinase US3 homolog OS=Suid herpesvirus 1 (strain NIA-3) GN=PK PE=3 SV=2 799 943 1.0E-11
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 803 905 1.0E-11
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 770 961 1.0E-11
sp|Q58D94|MKNK1_BOVIN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Bos taurus GN=MKNK1 PE=2 SV=2 768 962 1.0E-11
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 770 961 1.0E-11
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 803 922 1.0E-11
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 770 962 1.0E-11
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 770 954 1.0E-11
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 768 962 1.0E-11
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 803 928 1.0E-11
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 799 928 1.0E-11
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 745 904 1.0E-11
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 768 911 1.0E-11
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 803 961 1.0E-11
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 770 962 1.0E-11
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 803 928 1.0E-11
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 768 979 1.0E-11
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 770 954 1.0E-11
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 800 904 1.0E-11
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 771 905 1.0E-11
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 803 928 1.0E-11
sp|Q9Z2B5|E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus GN=Eif2ak3 PE=1 SV=1 581 666 2.0E-11
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 763 963 2.0E-11
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 770 962 2.0E-11
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 328 510 2.0E-11
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 745 904 2.0E-11
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 766 904 2.0E-11
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 771 905 2.0E-11
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 771 905 2.0E-11
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 770 904 2.0E-11
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 770 905 2.0E-11
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 767 904 2.0E-11
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 768 1009 2.0E-11
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 767 962 2.0E-11
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 770 905 2.0E-11
sp|P75524|PKNS_MYCPN Putative serine/threonine-protein kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_248 PE=3 SV=1 772 905 2.0E-11
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 768 911 2.0E-11
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 767 980 2.0E-11
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 803 928 2.0E-11
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 767 902 2.0E-11
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 768 957 2.0E-11
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 794 961 2.0E-11
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 756 904 2.0E-11
sp|Q550L8|IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum GN=ifkB PE=2 SV=1 602 666 3.0E-11
sp|Q9NZJ5|E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 589 666 3.0E-11
sp|Q9Z1Z1|E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus GN=Eif2ak3 PE=1 SV=1 589 666 4.0E-11
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 294 579 4.0E-10
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 247 547 8.0E-10
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 372 569 1.0E-09
sp|Q9NIV1|E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster GN=PEK PE=1 SV=2 589 665 2.0E-09
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 372 570 2.0E-09
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 277 547 2.0E-09
sp|D0Z5N4|E2AKB_CAEEL Eukaryotic translation initiation factor 2-alpha kinase gcn-2 OS=Caenorhabditis elegans GN=gcn-2 PE=1 SV=2 602 678 3.0E-09
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 277 552 3.0E-09
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 770 904 3.0E-09
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 317 586 4.0E-09
sp|Q54RP7|Y0652_DICDI Probable serine/threonine-protein kinase DDB_G0283065 OS=Dictyostelium discoideum GN=DDB_G0283065 PE=3 SV=1 591 663 4.0E-09
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 380 494 4.0E-09
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 770 903 4.0E-09
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 380 494 7.0E-09
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 380 494 7.0E-09
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 770 903 7.0E-09
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 277 547 8.0E-09
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 380 494 8.0E-09
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 295 554 1.0E-08
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 362 497 1.0E-08
sp|Q55F45|Y8642_DICDI Probable serine/threonine-protein kinase DDB_G0268642 OS=Dictyostelium discoideum GN=DDB_G0268642 PE=3 SV=1 582 665 2.0E-08
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 327 548 2.0E-08
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 327 553 2.0E-08
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 591 675 3.0E-08
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 397 548 3.0E-08
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 397 548 3.0E-08
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 397 548 3.0E-08
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 317 502 3.0E-08
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 391 553 3.0E-08
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 380 494 3.0E-08
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 327 497 3.0E-08
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 391 553 3.0E-08
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 294 629 3.0E-08
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 391 553 3.0E-08
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 391 553 3.0E-08
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 391 553 4.0E-08
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 391 497 5.0E-08
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 277 553 5.0E-08
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 327 565 5.0E-08
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 320 546 7.0E-08
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 250 497 7.0E-08
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 315 560 8.0E-08
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 770 923 8.0E-08
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 315 560 9.0E-08
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 315 560 9.0E-08
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 387 575 9.0E-08
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 391 553 9.0E-08
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 391 553 9.0E-08
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 391 553 9.0E-08
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 391 553 9.0E-08
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 570 660 1.0E-07
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 380 494 1.0E-07
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 770 962 1.0E-07
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 380 494 1.0E-07
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 297 547 1.0E-07
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 274 497 1.0E-07
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 391 553 2.0E-07
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 770 962 2.0E-07
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 327 547 2.0E-07
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 379 551 2.0E-07
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 371 551 2.0E-07
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 380 494 3.0E-07
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 390 549 3.0E-07
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 391 570 3.0E-07
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 391 553 3.0E-07
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 385 548 3.0E-07
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 385 548 3.0E-07
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 396 497 3.0E-07
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 396 497 3.0E-07
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 277 547 3.0E-07
sp|Q19192|E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans GN=pek-1 PE=1 SV=2 578 665 4.0E-07
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 251 552 4.0E-07
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 391 553 4.0E-07
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 391 553 4.0E-07
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 294 497 4.0E-07
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 385 548 4.0E-07
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 259 536 4.0E-07
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 278 585 5.0E-07
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 391 553 5.0E-07
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 391 553 5.0E-07
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 391 553 5.0E-07
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 584 688 6.0E-07
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 264 498 6.0E-07
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 278 535 7.0E-07
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 283 498 7.0E-07
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 364 497 7.0E-07
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 259 536 8.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 770 961 8.0E-07
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 328 547 8.0E-07
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 390 572 9.0E-07
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 390 548 1.0E-06
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 259 536 1.0E-06
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 227 536 1.0E-06
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 302 547 2.0E-06
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 392 536 2.0E-06
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 392 536 2.0E-06
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 365 541 2.0E-06
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 324 547 2.0E-06
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 284 497 3.0E-06
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 328 567 3.0E-06
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 392 536 3.0E-06
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 278 547 3.0E-06
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 382 502 4.0E-06
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 278 547 4.0E-06
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 316 497 4.0E-06
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 328 547 5.0E-06
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 377 550 5.0E-06
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 361 547 5.0E-06
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 399 552 5.0E-06
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 365 541 6.0E-06
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 399 552 6.0E-06
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 367 548 7.0E-06
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 316 498 7.0E-06
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 300 551 7.0E-06
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 399 552 9.0E-06
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 372 497 9.0E-06
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 262 541 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3535
MAGKPSGIWKSPLNNKQARDDASFPGLKPTNPDVTTKIEYEELQENELLALEAIYGDDFVKHSDAPSAWKKAEPS
FDIHIKASTDSDFAVTVGFVMTATYPKTPPRLTVKGLDSLRDSAQAKINKFIETEPRVFARDEQEMIDKIVEGVR
DILEDAAQAQASGNQLPSLEEERERHEADLARLAQEQREREERKKLEETKEEERVMSEMLQQQLDRQRQKAKESK
LNRRANGMSSSQPPDSSSGFDQVDFDQFCDITDRTGNSITFRSVAGKCDARQGQVSTVYTVRPVLPHGQSSQVVA
LKEAVLRSTGKDPKDVKKQIQSLESRLQDLKTVKRVQHRHIVEIIDFKVESGLPDDPAASSAWTVRILTPIADKG
PLEELLELAGNLEIDKVRSWTRDLLDALNFLHNKNIAHQDIHPGNILLFRESTGEIVPKISDAWYQREIHNASTP
KQGLPGLGSAKSAYWLPPEIASASKPQYTYKSDIWDFGVVFVQMIFGRDVLQKYSSPRNLMDSLSLSQPLQELVS
RFFKEDKQKRPRAFELGSSEFLATDAPVLFEGGPPVISPSPLMQALQVFPSKLRRDSMTRGSVVSRYTEDFVEEG
RLGKGGFGEVVKARKKLDGQFYAIKKITQRSQASLTEILKEVRLLSQLSHPAVVRYYNTWVEEVPDLTDTEGETS
TDDYTEETAGTGSAGIDIQFATSTGGLDFMSSNAPVEFACDDESDDDDDDDDEDESDESSDAEDAAGFRPLSPVR
ERRASIQRRARFQRPFRTILYISMEYCEKRTLRDLISRHLCKNTAEIWRLFRQILEGLAYIHGLSIVHRDLKPEN
IFISSGVDGVDNVKIGDFGLATSGQFSVDKVAANALGTDDMTRSIGTAYYSAPEVRSTADGMYSTKVDMYSLGII
FFEMCYEPMLGMQKADVITQLRRLQPVLPADFKPADKTQTDIVLALVKHNPKERPSSADLLKSGKLPVQMESETI
RRTLAGLSDPSSPYYRKMLSTLFSRPIEAAKDYAWDMFATSPSPAELLNQGIIKNALVSIFRRHGALETPRSFIY
PRSPHYGDNVVQLLDSNGTLLQLPYDLTMGHARTMAKHAPGIQKSFQFGTVFRDRKDTGQPQMFGEVDFDIVTGD
TLDLALKEAEVLKVLDEIIFTFPSLSSGQMCFHIGHSDLLQLIFEHCGIEPPCRRAAADVLSRLNIHNHTWQKVR
LELRSPAVGISATSVDELQRFDFRDTPNKAFSKLRLLFEGSDMYQRASSTIAHLKEVAEYTKRFGISTKVYVNPL
NSLKEGFYMGGILFSCLYDKKVKDVFAAGGRYDHLIKEQRPKTGGRFDERHAVGFSLAWERLARIPKSGGKSFLK
KPEDEAGVVLPGKRCDALVASFDTAVLRSTGIEILEMLWAHDVSAELAKDARSPEDLFSKHRDESYSWIIIIKQD
SMLKIKTMGRSDIADVDVSTGQLLSWMRSQGGGRDSKTTTKLRGGASQSESSAATGEKDHEQDVKILVAQTKSKK
FNRRTVVEQAQASAASLVRSFLDGPILAVETSDQVMDLVRESCLSDHESWRKVEHTVTTSEKRYVRELHDQLDTW
RWTYEKKNGSRHAFIYNFRSGTCLYYDLGS*
Coding >Hirsu2|3535
ATGGCTGGAAAACCGTCTGGGATATGGAAGTCGCCACTGAACAACAAGCAAGCTCGCGATGACGCCAGCTTCCCG
GGCCTCAAGCCCACGAACCCGGACGTAACCACCAAGATCGAGTATGAGGAGCTCCAGGAGAACGAGCTTCTGGCG
CTCGAGGCCATCTACGGCGACGACTTCGTAAAGCACAGCGATGCACCCAGTGCCTGGAAAAAAGCCGAGCCGTCA
TTCGACATTCACATCAAAGCGTCGACCGACAGCGACTTCGCCGTGACTGTCGGTTTTGTCATGACTGCGACGTAC
CCCAAGACGCCGCCCCGGCTGACCGTCAAAGGTCTCGATAGTCTCCGAGATTCCGCCCAGGCCAAGATCAACAAG
TTCATCGAGACGGAGCCCAGGGTCTTCGCGAGGGACGAGCAAGAAATGATCGACAAGATCGTCGAGGGAGTCAGG
GACATTCTCGAAGATGCGGCGCAGGCCCAAGCAAGCGGCAACCAGCTGCCCTCCCTCGAAGAAGAGCGCGAGCGT
CACGAGGCCGACCTCGCTCGGCTGGCTCAGGAGCAGCGGGAGCGAGAGGAGCGCAAGAAGCTGGAGGAGACGAAA
GAGGAAGAAAGGGTCATGTCCGAGATGCTGCAGCAACAACTTGATCGTCAGAGACAAAAGGCCAAAGAGTCCAAG
CTCAATCGTCGCGCCAATGGCATGTCCTCGAGTCAGCCGCCTGACTCCAGCTCTGGTTTCGACCAGGTAGATTTT
GACCAGTTCTGTGACATCACCGACAGGACAGGAAATTCCATCACCTTCCGTTCGGTAGCCGGTAAATGTGACGCC
CGACAAGGCCAAGTATCTACCGTCTATACTGTCCGCCCTGTTCTCCCGCACGGCCAAAGCAGTCAGGTCGTGGCC
CTCAAGGAGGCTGTTCTTCGCTCGACCGGCAAAGATCCCAAGGACGTCAAGAAGCAGATCCAGTCTCTCGAGTCG
CGGCTGCAAGATCTCAAGACGGTCAAGAGAGTGCAACATCGCCACATCGTCGAAATCATAGACTTCAAGGTCGAA
AGCGGGCTTCCCGACGACCCCGCTGCTTCCAGTGCCTGGACCGTCAGGATTCTCACTCCGATCGCCGACAAGGGG
CCTCTCGAAGAGCTGTTGGAGCTTGCTGGAAATCTCGAGATCGACAAGGTCCGATCCTGGACCAGGGATCTCCTT
GATGCCCTGAATTTCCTTCACAACAAAAACATAGCGCATCAGGACATCCACCCTGGCAACATTCTTCTCTTTCGA
GAGTCGACGGGGGAGATTGTGCCCAAGATCTCCGACGCCTGGTATCAGAGGGAGATTCACAATGCCAGCACCCCG
AAACAGGGCCTCCCCGGTCTGGGCTCTGCCAAGTCGGCTTATTGGCTTCCTCCCGAGATAGCCAGTGCGTCCAAG
CCACAGTACACGTACAAGTCGGACATATGGGACTTCGGCGTCGTCTTCGTACAAATGATATTTGGCCGAGACGTC
CTTCAGAAGTATTCGTCGCCCAGAAATCTCATGGACTCGCTCAGTCTGTCCCAGCCCCTGCAGGAGCTGGTGAGC
CGGTTCTTCAAGGAGGACAAACAAAAGCGTCCTCGGGCGTTCGAGCTCGGGTCTAGCGAGTTCTTAGCAACAGAT
GCCCCAGTCCTTTTTGAAGGGGGGCCCCCCGTCATTTCGCCTTCTCCCCTGATGCAGGCGCTGCAGGTCTTTCCC
TCGAAACTGCGTCGTGATTCGATGACGCGGGGTTCCGTCGTATCACGATATACAGAGGACTTTGTCGAGGAGGGT
CGGCTTGGGAAAGGCGGCTTCGGCGAAGTGGTCAAGGCCAGGAAGAAGCTCGATGGCCAGTTCTATGCCATCAAG
AAGATCACCCAGCGATCGCAGGCCAGTCTGACCGAGATCCTCAAAGAAGTCCGCTTGCTCTCGCAACTTAGCCAC
CCGGCTGTGGTACGGTATTACAACACCTGGGTCGAAGAAGTCCCAGATCTGACAGATACCGAGGGCGAGACCTCG
ACCGACGATTACACCGAAGAGACCGCAGGGACTGGGTCAGCCGGCATCGACATACAGTTCGCCACGAGCACCGGA
GGGCTGGATTTCATGTCGTCCAATGCTCCCGTCGAGTTCGCCTGTGATGACGAGTCCGACGATGACGACGACGAC
GACGACGAAGACGAGTCTGATGAAAGCTCTGACGCCGAGGATGCCGCCGGTTTTCGGCCCCTGTCGCCGGTGAGA
GAGAGACGGGCCTCGATACAGCGTCGTGCCAGGTTCCAGAGGCCGTTCAGGACCATTCTCTACATCTCAATGGAG
TACTGCGAAAAACGGACCCTTCGCGACCTGATATCCCGCCACCTCTGCAAGAACACAGCCGAGATCTGGCGTCTT
TTCCGGCAAATCCTCGAAGGTTTGGCTTACATCCACGGCCTGAGCATCGTTCACCGCGACTTGAAGCCAGAAAAC
ATCTTCATCAGCAGCGGCGTCGACGGCGTGGACAACGTGAAGATAGGAGACTTCGGCTTGGCGACAAGTGGACAG
TTCTCGGTTGATAAAGTCGCCGCCAATGCCCTCGGGACGGATGACATGACGAGAAGCATCGGCACGGCATACTAT
TCCGCGCCGGAAGTCAGGTCGACGGCAGACGGAATGTACAGCACCAAGGTCGATATGTACTCCCTGGGAATCATT
TTCTTCGAGATGTGCTACGAGCCAATGTTGGGGATGCAGAAGGCGGACGTGATCACTCAGCTGCGGCGTCTGCAA
CCGGTGCTCCCGGCAGACTTCAAGCCTGCCGACAAAACGCAGACCGATATTGTGCTTGCCCTCGTCAAACACAAT
CCAAAGGAACGACCTTCCAGTGCTGATTTGCTGAAGAGCGGCAAGCTGCCTGTCCAAATGGAGAGCGAGACGATT
AGGCGCACTCTGGCGGGTCTGTCCGATCCGAGCTCCCCCTACTATCGGAAAATGCTCAGCACGCTATTTTCTCGA
CCCATCGAAGCGGCCAAGGACTACGCTTGGGACATGTTTGCGACCTCTCCGAGCCCCGCCGAGCTCCTGAATCAG
GGCATCATCAAAAATGCCCTCGTGTCCATCTTCCGCCGACACGGTGCCCTGGAGACGCCCCGCAGCTTCATCTAC
CCCCGGTCGCCGCACTACGGCGATAACGTCGTTCAGCTTCTGGATTCAAACGGTACGCTGCTCCAGCTGCCCTAC
GATCTGACCATGGGCCACGCGCGGACGATGGCCAAGCACGCCCCCGGAATACAAAAGTCATTCCAGTTTGGTACC
GTGTTCCGGGATAGGAAGGATACGGGCCAGCCGCAGATGTTTGGGGAGGTGGACTTCGATATCGTCACCGGCGAC
ACGCTAGATCTTGCCCTTAAGGAGGCAGAGGTGTTGAAGGTGCTCGACGAGATCATATTCACGTTTCCCTCGTTG
TCGTCGGGCCAGATGTGCTTCCACATTGGCCATTCGGATCTTCTCCAGCTCATCTTTGAGCATTGCGGGATCGAA
CCGCCCTGCAGGAGAGCGGCTGCCGACGTGCTGAGCAGATTAAACATCCACAATCACACATGGCAAAAGGTCAGG
CTGGAGCTGCGATCGCCGGCCGTGGGCATTTCCGCGACAAGCGTCGATGAGCTGCAGCGGTTTGACTTTCGAGAC
ACACCCAATAAGGCGTTTTCGAAACTCAGGCTGCTTTTTGAGGGTAGCGACATGTACCAGAGAGCCTCTTCCACG
ATCGCGCACCTTAAAGAGGTCGCGGAATACACCAAGCGGTTCGGCATTTCTACAAAGGTCTACGTCAACCCGCTC
AACAGTCTGAAAGAGGGTTTCTACATGGGGGGCATCTTATTTTCGTGCCTATACGACAAGAAAGTGAAGGATGTG
TTTGCTGCCGGCGGCCGTTACGACCACTTGATCAAGGAGCAACGACCGAAGACCGGTGGCCGGTTTGACGAGAGG
CATGCTGTTGGGTTCAGTCTGGCGTGGGAGCGGCTAGCAAGAATCCCCAAGTCGGGGGGCAAGTCTTTCCTCAAG
AAGCCCGAGGATGAGGCGGGTGTCGTACTTCCCGGGAAGAGGTGCGATGCTCTGGTAGCCAGCTTTGACACGGCA
GTCCTCCGGTCTACAGGAATTGAAATTCTGGAGATGCTCTGGGCCCACGACGTGAGCGCGGAGCTGGCCAAGGAC
GCCAGATCTCCCGAGGATCTATTCTCGAAACACCGAGACGAGAGCTACTCTTGGATCATTATCATCAAGCAGGAT
TCCATGCTCAAGATCAAGACGATGGGCAGGAGCGATATTGCCGATGTGGACGTCTCGACGGGGCAGCTCCTTTCG
TGGATGCGATCTCAAGGGGGCGGGCGAGACTCGAAAACAACGACGAAGCTGAGAGGCGGCGCCTCTCAGTCTGAA
AGCTCTGCAGCAACAGGGGAGAAGGACCACGAACAGGATGTCAAGATCCTGGTGGCCCAGACGAAGAGCAAGAAG
TTCAACCGGCGGACAGTGGTGGAGCAGGCGCAAGCTAGCGCGGCCAGCTTGGTGCGATCGTTTCTGGACGGGCCG
ATCCTGGCCGTCGAAACTTCGGACCAAGTGATGGACCTTGTGCGAGAAAGCTGCCTGTCTGACCACGAAAGCTGG
CGGAAAGTCGAGCATACGGTGACGACATCGGAGAAGAGGTATGTGCGAGAGCTACACGATCAGCTGGACACATGG
CGATGGACATATGAGAAAAAGAACGGGTCAAGACACGCCTTCATCTACAACTTTCGATCGGGAACCTGCCTTTAC
TACGATTTGGGTAGCTGA
Transcript >Hirsu2|3535
ATGGCTGGAAAACCGTCTGGGATATGGAAGTCGCCACTGAACAACAAGCAAGCTCGCGATGACGCCAGCTTCCCG
GGCCTCAAGCCCACGAACCCGGACGTAACCACCAAGATCGAGTATGAGGAGCTCCAGGAGAACGAGCTTCTGGCG
CTCGAGGCCATCTACGGCGACGACTTCGTAAAGCACAGCGATGCACCCAGTGCCTGGAAAAAAGCCGAGCCGTCA
TTCGACATTCACATCAAAGCGTCGACCGACAGCGACTTCGCCGTGACTGTCGGTTTTGTCATGACTGCGACGTAC
CCCAAGACGCCGCCCCGGCTGACCGTCAAAGGTCTCGATAGTCTCCGAGATTCCGCCCAGGCCAAGATCAACAAG
TTCATCGAGACGGAGCCCAGGGTCTTCGCGAGGGACGAGCAAGAAATGATCGACAAGATCGTCGAGGGAGTCAGG
GACATTCTCGAAGATGCGGCGCAGGCCCAAGCAAGCGGCAACCAGCTGCCCTCCCTCGAAGAAGAGCGCGAGCGT
CACGAGGCCGACCTCGCTCGGCTGGCTCAGGAGCAGCGGGAGCGAGAGGAGCGCAAGAAGCTGGAGGAGACGAAA
GAGGAAGAAAGGGTCATGTCCGAGATGCTGCAGCAACAACTTGATCGTCAGAGACAAAAGGCCAAAGAGTCCAAG
CTCAATCGTCGCGCCAATGGCATGTCCTCGAGTCAGCCGCCTGACTCCAGCTCTGGTTTCGACCAGGTAGATTTT
GACCAGTTCTGTGACATCACCGACAGGACAGGAAATTCCATCACCTTCCGTTCGGTAGCCGGTAAATGTGACGCC
CGACAAGGCCAAGTATCTACCGTCTATACTGTCCGCCCTGTTCTCCCGCACGGCCAAAGCAGTCAGGTCGTGGCC
CTCAAGGAGGCTGTTCTTCGCTCGACCGGCAAAGATCCCAAGGACGTCAAGAAGCAGATCCAGTCTCTCGAGTCG
CGGCTGCAAGATCTCAAGACGGTCAAGAGAGTGCAACATCGCCACATCGTCGAAATCATAGACTTCAAGGTCGAA
AGCGGGCTTCCCGACGACCCCGCTGCTTCCAGTGCCTGGACCGTCAGGATTCTCACTCCGATCGCCGACAAGGGG
CCTCTCGAAGAGCTGTTGGAGCTTGCTGGAAATCTCGAGATCGACAAGGTCCGATCCTGGACCAGGGATCTCCTT
GATGCCCTGAATTTCCTTCACAACAAAAACATAGCGCATCAGGACATCCACCCTGGCAACATTCTTCTCTTTCGA
GAGTCGACGGGGGAGATTGTGCCCAAGATCTCCGACGCCTGGTATCAGAGGGAGATTCACAATGCCAGCACCCCG
AAACAGGGCCTCCCCGGTCTGGGCTCTGCCAAGTCGGCTTATTGGCTTCCTCCCGAGATAGCCAGTGCGTCCAAG
CCACAGTACACGTACAAGTCGGACATATGGGACTTCGGCGTCGTCTTCGTACAAATGATATTTGGCCGAGACGTC
CTTCAGAAGTATTCGTCGCCCAGAAATCTCATGGACTCGCTCAGTCTGTCCCAGCCCCTGCAGGAGCTGGTGAGC
CGGTTCTTCAAGGAGGACAAACAAAAGCGTCCTCGGGCGTTCGAGCTCGGGTCTAGCGAGTTCTTAGCAACAGAT
GCCCCAGTCCTTTTTGAAGGGGGGCCCCCCGTCATTTCGCCTTCTCCCCTGATGCAGGCGCTGCAGGTCTTTCCC
TCGAAACTGCGTCGTGATTCGATGACGCGGGGTTCCGTCGTATCACGATATACAGAGGACTTTGTCGAGGAGGGT
CGGCTTGGGAAAGGCGGCTTCGGCGAAGTGGTCAAGGCCAGGAAGAAGCTCGATGGCCAGTTCTATGCCATCAAG
AAGATCACCCAGCGATCGCAGGCCAGTCTGACCGAGATCCTCAAAGAAGTCCGCTTGCTCTCGCAACTTAGCCAC
CCGGCTGTGGTACGGTATTACAACACCTGGGTCGAAGAAGTCCCAGATCTGACAGATACCGAGGGCGAGACCTCG
ACCGACGATTACACCGAAGAGACCGCAGGGACTGGGTCAGCCGGCATCGACATACAGTTCGCCACGAGCACCGGA
GGGCTGGATTTCATGTCGTCCAATGCTCCCGTCGAGTTCGCCTGTGATGACGAGTCCGACGATGACGACGACGAC
GACGACGAAGACGAGTCTGATGAAAGCTCTGACGCCGAGGATGCCGCCGGTTTTCGGCCCCTGTCGCCGGTGAGA
GAGAGACGGGCCTCGATACAGCGTCGTGCCAGGTTCCAGAGGCCGTTCAGGACCATTCTCTACATCTCAATGGAG
TACTGCGAAAAACGGACCCTTCGCGACCTGATATCCCGCCACCTCTGCAAGAACACAGCCGAGATCTGGCGTCTT
TTCCGGCAAATCCTCGAAGGTTTGGCTTACATCCACGGCCTGAGCATCGTTCACCGCGACTTGAAGCCAGAAAAC
ATCTTCATCAGCAGCGGCGTCGACGGCGTGGACAACGTGAAGATAGGAGACTTCGGCTTGGCGACAAGTGGACAG
TTCTCGGTTGATAAAGTCGCCGCCAATGCCCTCGGGACGGATGACATGACGAGAAGCATCGGCACGGCATACTAT
TCCGCGCCGGAAGTCAGGTCGACGGCAGACGGAATGTACAGCACCAAGGTCGATATGTACTCCCTGGGAATCATT
TTCTTCGAGATGTGCTACGAGCCAATGTTGGGGATGCAGAAGGCGGACGTGATCACTCAGCTGCGGCGTCTGCAA
CCGGTGCTCCCGGCAGACTTCAAGCCTGCCGACAAAACGCAGACCGATATTGTGCTTGCCCTCGTCAAACACAAT
CCAAAGGAACGACCTTCCAGTGCTGATTTGCTGAAGAGCGGCAAGCTGCCTGTCCAAATGGAGAGCGAGACGATT
AGGCGCACTCTGGCGGGTCTGTCCGATCCGAGCTCCCCCTACTATCGGAAAATGCTCAGCACGCTATTTTCTCGA
CCCATCGAAGCGGCCAAGGACTACGCTTGGGACATGTTTGCGACCTCTCCGAGCCCCGCCGAGCTCCTGAATCAG
GGCATCATCAAAAATGCCCTCGTGTCCATCTTCCGCCGACACGGTGCCCTGGAGACGCCCCGCAGCTTCATCTAC
CCCCGGTCGCCGCACTACGGCGATAACGTCGTTCAGCTTCTGGATTCAAACGGTACGCTGCTCCAGCTGCCCTAC
GATCTGACCATGGGCCACGCGCGGACGATGGCCAAGCACGCCCCCGGAATACAAAAGTCATTCCAGTTTGGTACC
GTGTTCCGGGATAGGAAGGATACGGGCCAGCCGCAGATGTTTGGGGAGGTGGACTTCGATATCGTCACCGGCGAC
ACGCTAGATCTTGCCCTTAAGGAGGCAGAGGTGTTGAAGGTGCTCGACGAGATCATATTCACGTTTCCCTCGTTG
TCGTCGGGCCAGATGTGCTTCCACATTGGCCATTCGGATCTTCTCCAGCTCATCTTTGAGCATTGCGGGATCGAA
CCGCCCTGCAGGAGAGCGGCTGCCGACGTGCTGAGCAGATTAAACATCCACAATCACACATGGCAAAAGGTCAGG
CTGGAGCTGCGATCGCCGGCCGTGGGCATTTCCGCGACAAGCGTCGATGAGCTGCAGCGGTTTGACTTTCGAGAC
ACACCCAATAAGGCGTTTTCGAAACTCAGGCTGCTTTTTGAGGGTAGCGACATGTACCAGAGAGCCTCTTCCACG
ATCGCGCACCTTAAAGAGGTCGCGGAATACACCAAGCGGTTCGGCATTTCTACAAAGGTCTACGTCAACCCGCTC
AACAGTCTGAAAGAGGGTTTCTACATGGGGGGCATCTTATTTTCGTGCCTATACGACAAGAAAGTGAAGGATGTG
TTTGCTGCCGGCGGCCGTTACGACCACTTGATCAAGGAGCAACGACCGAAGACCGGTGGCCGGTTTGACGAGAGG
CATGCTGTTGGGTTCAGTCTGGCGTGGGAGCGGCTAGCAAGAATCCCCAAGTCGGGGGGCAAGTCTTTCCTCAAG
AAGCCCGAGGATGAGGCGGGTGTCGTACTTCCCGGGAAGAGGTGCGATGCTCTGGTAGCCAGCTTTGACACGGCA
GTCCTCCGGTCTACAGGAATTGAAATTCTGGAGATGCTCTGGGCCCACGACGTGAGCGCGGAGCTGGCCAAGGAC
GCCAGATCTCCCGAGGATCTATTCTCGAAACACCGAGACGAGAGCTACTCTTGGATCATTATCATCAAGCAGGAT
TCCATGCTCAAGATCAAGACGATGGGCAGGAGCGATATTGCCGATGTGGACGTCTCGACGGGGCAGCTCCTTTCG
TGGATGCGATCTCAAGGGGGCGGGCGAGACTCGAAAACAACGACGAAGCTGAGAGGCGGCGCCTCTCAGTCTGAA
AGCTCTGCAGCAACAGGGGAGAAGGACCACGAACAGGATGTCAAGATCCTGGTGGCCCAGACGAAGAGCAAGAAG
TTCAACCGGCGGACAGTGGTGGAGCAGGCGCAAGCTAGCGCGGCCAGCTTGGTGCGATCGTTTCTGGACGGGCCG
ATCCTGGCCGTCGAAACTTCGGACCAAGTGATGGACCTTGTGCGAGAAAGCTGCCTGTCTGACCACGAAAGCTGG
CGGAAAGTCGAGCATACGGTGACGACATCGGAGAAGAGGTATGTGCGAGAGCTACACGATCAGCTGGACACATGG
CGATGGACATATGAGAAAAAGAACGGGTCAAGACACGCCTTCATCTACAACTTTCGATCGGGAACCTGCCTTTAC
TACGATTTGGGTAGCTGA
Gene >Hirsu2|3535
ATGGCTGGAAAACCGTCTGGGATATGGAAGTCGCCACTGAACAACAAGCAAGCTCGCGATGACGCCAGCTTCCCG
GGCCTCAAGCCCACGAACCCGGACGTAACCACCAAGATCGAGTATGAGGAGCTCCAGGAGAACGAGCTTCTGGCG
CTCGAGGCCATCTACGGCGACGACTTCGTAAAGCACAGCGATGCACCCAGTGCCTGGAAAGTGTGTGCTGTCCTT
GTTCCCTCCTCACCCTACCCTGCTGACCCAAGCCAGAAAGCCGAGCCGTCATTCGACATTCACATCAAAGCGTCG
ACCGACAGCGACTTCGCCGTGACTGTCGGTTTTGTCATGACTGCGACGTACCCCAAGACGCCGCCCCGGCTGACC
GTCAAAGGTCTCGATAGTCTCCGAGATTCCGCCCAGGCCAAGATCAACAAGTTCATCGAGACGGAGCCCAGGGTC
TTCGCGAGGGACGAGCAAGAAATGATCGACAAGATCGTCGAGGGAGTCAGGGACATTCTCGAAGATGCGGCGCAG
GCCCAAGCAAGCGGCAACCAGCTGCCCTCCCTCGAAGAAGAGCGCGAGCGTCACGAGGCCGACCTCGCTCGGCTG
GCTCAGGAGCAGCGGGAGCGAGAGGAGCGCAAGAAGCTGGAGGAGACGAAAGAGGAAGAAAGGGTCATGTCCGAG
ATGCTGCAGCAACAACTTGATCGTCAGAGACAAAAGGCCAAAGAGTCCAAGCTCAATCGTCGCGCCAATGGCATG
TCCTCGAGTCAGCCGCCTGACTCCAGCTCTGGTTTCGACCAGGTAGATTTTGACCAGTTCTGTGACATCACCGAC
AGGACAGGAAATTCCATCACCTTCCGTTCGGTAGCCGGTAAATGTGACGCCCGACAAGGCCAAGTATCTACCGTC
TATACTGTCCGCCCTGTTCTCCCGCACGGCCAAAGCAGTCAGGTCGTGGCCCTCAAGGAGGCTGTTCTTCGCTCG
ACCGGCAAAGATCCCAAGGACGTCAAGAAGCAGATCCAGTCTCTCGAGTCGCGGCTGCAAGATCTCAAGACGGTC
AAGAGAGTGCAACATCGCCACATCGTCGAAATCATAGACTTCAAGGTCGAAAGCGGGCTTCCCGACGACCCCGCT
GCTTCCAGTGCCTGGACCGTCAGGATTCTCACTCCGATCGCCGACAAGGGGCCTCTCGAAGAGCTGTTGGAGCTT
GCTGGAAATCTCGAGATCGACAAGGTCCGATCCTGGACCAGGGATCTCCTTGATGCCCTGAATTTCCTTCACAAC
AAAAACATAGCGCATCAGGACATCCACCCTGGCAACATTCTTCTCTTTCGAGAGTCGACGGGGGAGATTGTGCCC
AAGATCTCCGACGCCTGGTATCAGAGGGAGATTCACAATGCCAGCACCCCGAAACAGGGCCTCCCCGGTCTGGGC
TCTGCCAAGTCGGCTTATTGGCTTCCTCCCGAGATAGCCAGTGCGTCCAAGCCACAGTACACGTACAAGTCGGAC
ATATGGGACTTCGGCGTCGTCTTCGTACAAATGATATTTGGCCGAGACGTCCTTCAGAAGTATTCGTCGCCCAGA
AATCTCATGGACTCGCTCAGTCTGTCCCAGCCCCTGCAGGAGCTGGTGAGCCGGTTCTTCAAGGAGGACAAACAA
AAGCGTCCTCGGGCGTTCGAGCTCGGGTCTAGCGAGTTCTTAGCAACAGATGCCCCAGTCCTTTTTGAAGGGGGG
CCCCCCGTCATTTCGCCTTCTCCCCTGATGCAGGCGCTGCAGGTCTTTCCCTCGAAACTGCGTCGTGATTCGATG
ACGCGGGGTTCCGTCGTATCACGATATACAGAGGACTTTGTCGAGGAGGGTCGGCTTGGGAAAGGCGGCTTCGGC
GAAGTGGTCAAGGCCAGGAAGAAGCTCGATGGCCAGTTCTATGCCATCAAGAAGATCACCCAGCGATCGCAGGCC
AGTCTGACCGAGATCCTCAAAGAAGTCCGCTTGCTCTCGCAACTTAGCCACCCGGCTGTGGTACGGTATTACAAC
ACCTGGGTCGAAGAAGTCCCAGATCTGACAGATACCGAGGGCGAGACCTCGACCGACGATTACACCGAAGAGACC
GCAGGGACTGGGTCAGCCGGCATCGACATACAGTTCGCCACGAGCACCGGAGGGCTGGATTTCATGTCGTCCAAT
GCTCCCGTCGAGTTCGCCTGTGATGACGAGTCCGACGATGACGACGACGACGACGACGAAGACGAGTCTGATGAA
AGCTCTGACGCCGAGGATGCCGCCGGTTTTCGGCCCCTGTCGCCGGTGAGAGAGAGACGGGCCTCGATACAGCGT
CGTGCCAGGTTCCAGAGGCCGTTCAGGACCATTCTCTACATCTCAATGGAGTACTGCGAAAAACGGGTGGGTCCT
CTCTCTGGGCCCTTGATATATGGACCCGGCTGGCTTCCCGGCCTCACTGACCATCAGTAGACCCTTCGCGACCTG
ATATCCCGCCACCTCTGCAAGAACACAGCCGAGATCTGGCGTCTTTTCCGGCAAATCCTCGAAGGTTTGGCTTAC
ATCCACGGCCTGAGCATCGTTCACCGCGACTTGAAGCCAGAAAACATCTTCATCAGCAGCGGCGTCGACGGCGTG
GACAACGTGAAGATAGGAGACTTCGGCTTGGCGACAAGTGGACAGTTCTCGGTTGATAAAGTCGCCGCCAATGCC
CTCGGGACGGATGACATGACGAGAAGCATCGGCACGGCATACTATTCCGCGCCGGAAGTCAGGTCGACGGCAGAC
GGAATGTACAGCACCAAGGTCGATGTAAGCAAGATCCCCCGCCCCCATCCCTGGGGACTAGGCAGCACCGAGGCA
CTGACACAGCTGCTATCAGATGTACTCCCTGGGAATCATTTTCTTCGAGATGTGCTACGAGCCAATGTTGGGGAT
GCAGAAGGCGGACGTGATCACTCAGCTGCGGCGTCTGCAACCGGTGCTCCCGGCAGACTTCAAGCCTGCCGACAA
AACGCAGACCGATATTGTGCTTGCCCTCGTCAAACACAATCCAAAGGAACGACCTTCCAGTGCTGATTTGCTGAA
GAGCGGCAAGCTGCCTGTCCAAATGGAGAGCGAGACGATTAGGCGCACTCTGGCGGGTCTGTCCGATCCGAGCTC
CCCCTACTATCGGAAAATGCTCAGCACGCTATTTTCTCGACCCATCGAAGCGGCCAAGGACTACGCTTGGGACAT
GTTTGCGACCTCTCCGAGCCCCGCCGAGCTCCTGAATCAGGGCATCATCAAAAATGCCCTCGTGTCCATCTTCCG
CCGACACGGTGCCCTGGAGACGCCCCGCAGCTTCATCTACCCCCGGTCGCCGCACTACGGCGATAACGTCGTTCA
GCTTCTGGATTCAAACGGTACGCTGCTCCAGCTGCCCTACGATCTGACCATGGGCCACGCGCGGACGATGGCCAA
GCACGCCCCCGGAATACAAAAGTCATTCCAGTTTGGTACCGTGTTCCGGGATAGGAAGGATACGGGCCAGCCGCA
GATGTTTGGGGAGGTGGACTTCGATATCGTCACCGGCGACACGCTAGATCTTGCCCTTAAGGAGGCAGAGGTGTT
GAAGGTGCTCGACGAGATCATATTCACGTTTCCCTCGTTGTCGTCGGGCCAGATGTGCTTCCACATTGGCCATTC
GGATCTTCTCCAGCTCATCTTTGAGCATTGCGGGATCGAACCGCCCTGCAGGAGAGCGGCTGCCGACGTGCTGAG
CAGATTAAACATCCACAATCACACATGGCAAAAGGTCAGGCTGGAGCTGCGATCGCCGGCCGTGGGCATTTCCGC
GACAAGCGTCGATGAGCTGCAGCGGTTTGACTTTCGAGGTAAGAAACCCCCGGCTCAGCTTCGCACGGGGCCCGA
AACGGAGAAACGGCTAACAGGCCCGAAGACACACCCAATAAGGCGTTTTCGAAACTCAGGCTGCTTTTTGAGGGT
AGCGACATGTACCAGAGAGCCTCTTCCACGATCGCGCACCTTAAAGAGGTCGCGGAATACACCAAGCGGTTCGGC
ATTTCTACAAAGGTCTACGTCAACCCGCTCAACAGTCTGAAAGAGGGTTTCTACATGGGGGGCATCTTATTTTCG
TGCCTATACGACAAGAAAGTGAAGGATGTGTTTGCTGCCGGCGGCCGTTACGACCACTTGATCAAGGAGCAACGA
CCGAAGACCGGTGGCCGGTTTGACGAGAGGCATGCTGTTGGGTTCAGTCTGGCGTGGGAGCGGCTAGCAAGAATC
CCCAAGTCGGGGGGCAAGTCTTTCCTCAAGAAGCCCGAGGATGAGGCGGGTGTCGTACTTCCCGGGAAGAGGGTG
AGTCTTCCCATGACACTGCTTCGATTCATGGCCATCTGACCCAAGATGCCTCCTAGTGCGATGCTCTGGTAGCCA
GCTTTGACACGGCAGTCCTCCGGTCTACAGGAATTGAAATTCTGGAGATGCTCTGGGCCCACGACGTGAGCGCGG
AGCTGGCCAAGGACGCCAGATCTCCCGAGGATCTATTCTCGAAACACCGAGACGAGAGCTACTCTTGGATCATTA
TCATCAAGCAGGATTCCATGCTCAAGATCAAGACGATGGGCAGGAGCGATATTGCCGATGTGGACGTCTCGACGG
GGCAGCTCCTTTCGTGGATGCGATCTCAAGGGGGCGGGCGAGACTCGAAAACAACGACGAAGCTGAGAGGCGGCG
CCTCTCAGTCTGAAAGCTCTGCAGCAACAGGGGAGAAGGACCACGAACAGGATGTCAAGATCCTGGTGGCCCAGA
CGAAGAGCAAGAAGTTCAACCGGCGGACAGTGGTGGAGCAGGCGCAAGCTAGCGCGGCCAGCTTGGTGCGATCGT
TTCTGGACGGGCCGATCCTGGCCGTCGAAACTTCGGACCAAGTGATGGACCTTGTGCGAGAAAGCTGCCTGTCTG
ACCACGAAAGCTGGCGGAAAGTCGAGCATACGGTGACGACATCGGAGAAGAGGTATGTGCGAGAGCTACACGATC
AGCTGGACACATGGCGATGGACATATGAGAAAAAGAACGGGTCAAGACACGCCTTCATCTACAACTTTCGATCGG
GAACCTGCCTTTACTACGATTTGGGTAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail