Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3523
Gene name
LocationContig_1927:3250..4179
Strand-
Gene length (bp)929
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54IX6|STX8B_DICDI Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1 163 236 1.0E-07
sp|P83528|STX6_CAEEL Putative syntaxin 6 OS=Caenorhabditis elegans GN=syx-6 PE=3 SV=1 165 249 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 243 260 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3523
MAKTSQTFLLVDHIKLSLLERRQANVLDFDSGIYDGHISRSLEQLRNGLASLRQEKLSLEQAGDISAADSISTEI
ATLEKQYDVLKAQFSDLSEPSTEFTLEYANLESPAINFTHTAPIPRKLKTVRFTDSSSPPSDALFHPYEDDPMDT
SSGLRDQAGGMNNQQLYEYHSQILDAQDVQLDRLGESISRQRELSLQIGDELDTHVAMLDEVEVVTDRHQSRLDR
AMKALKTVARGGDENKQMAIIVIIVMALILLIVILK*
Coding >Hirsu2|3523
ATGGCGAAAACCAGCCAGACTTTCCTGCTAGTGGATCATATTAAACTATCGCTACTTGAACGTCGGCAGGCCAAT
GTATTGGACTTTGATAGCGGCATCTATGATGGGCACATATCGCGTTCTCTGGAACAGTTACGCAATGGACTAGCT
TCTCTACGGCAGGAGAAGTTGAGCCTAGAGCAGGCAGGCGACATTAGCGCTGCAGATTCTATTAGCACCGAAATT
GCGACTTTGGAGAAGCAGTACGACGTCTTGAAAGCCCAGTTCAGCGACCTCTCCGAACCGTCGACCGAATTCACG
CTCGAATATGCAAATCTCGAATCCCCCGCTATAAATTTCACACACACCGCACCAATTCCTCGCAAGCTGAAGACG
GTCCGCTTTACCGACTCATCCTCACCTCCTTCCGATGCCTTGTTCCACCCCTATGAGGACGATCCAATGGACACG
TCAAGCGGTTTACGTGATCAGGCCGGCGGCATGAACAACCAGCAGCTGTACGAGTATCACTCACAAATCCTTGAC
GCGCAGGACGTGCAACTTGATCGCTTGGGCGAGTCAATTAGTCGTCAGAGAGAGCTGAGCCTTCAAATCGGTGAT
GAGCTAGACACTCATGTTGCCATGCTGGATGAGGTTGAGGTTGTGACCGATCGACATCAAAGTCGCTTGGATCGT
GCAATGAAAGCGCTCAAGACAGTGGCCAGGGGAGGCGATGAAAATAAGCAAATGGCCATTATTGTCATCATTGTG
ATGGCCCTAATCCTGTTGATCGTGATTCTCAAATAA
Transcript >Hirsu2|3523
ATGGCGAAAACCAGCCAGACTTTCCTGCTAGTGGATCATATTAAACTATCGCTACTTGAACGTCGGCAGGCCAAT
GTATTGGACTTTGATAGCGGCATCTATGATGGGCACATATCGCGTTCTCTGGAACAGTTACGCAATGGACTAGCT
TCTCTACGGCAGGAGAAGTTGAGCCTAGAGCAGGCAGGCGACATTAGCGCTGCAGATTCTATTAGCACCGAAATT
GCGACTTTGGAGAAGCAGTACGACGTCTTGAAAGCCCAGTTCAGCGACCTCTCCGAACCGTCGACCGAATTCACG
CTCGAATATGCAAATCTCGAATCCCCCGCTATAAATTTCACACACACCGCACCAATTCCTCGCAAGCTGAAGACG
GTCCGCTTTACCGACTCATCCTCACCTCCTTCCGATGCCTTGTTCCACCCCTATGAGGACGATCCAATGGACACG
TCAAGCGGTTTACGTGATCAGGCCGGCGGCATGAACAACCAGCAGCTGTACGAGTATCACTCACAAATCCTTGAC
GCGCAGGACGTGCAACTTGATCGCTTGGGCGAGTCAATTAGTCGTCAGAGAGAGCTGAGCCTTCAAATCGGTGAT
GAGCTAGACACTCATGTTGCCATGCTGGATGAGGTTGAGGTTGTGACCGATCGACATCAAAGTCGCTTGGATCGT
GCAATGAAAGCGCTCAAGACAGTGGCCAGGGGAGGCGATGAAAATAAGCAAATGGCCATTATTGTCATCATTGTG
ATGGCCCTAATCCTGTTGATCGTGATTCTCAAATAA
Gene >Hirsu2|3523
ATGGCGAAAACCAGCCAGACTTTCCTGCTAGTGGATCATATTAAACTATCGCTACTTGAACGTCGGCAGGCCAAT
GTATTGGACTTTGATAGCGGCATCTATGATGGGCACATATCGCGTTCTCTGGAACAGTTACGCAATGGACTAGCT
TCTCTACGGCAGGAGAAGTTGAGCCTAGAGCAGGCAGGCGACATTAGGTAAGACCTCGCCCGGCGAGCCCCGGTC
ATGTGTCTTGTTTCTCCTCTTTCTGTACAGAGGATACCGCCTATCTATTCTTTTCCTTTTCACAACATCAACCCG
TCTGAAACCATAGGCCCGAGGCATCACTGACACTCCCCAGCGCTGCAGATTCTATTAGCACCGAAATTGCGACTT
TGGAGAAGCAGTACGACGTCTTGAAAGCCCAGTTCAGCGACCTCTCCGAACCGTCGACCGAATTCACGCTCGAAT
ATGCAAATCTCGAATCCCCCGCTATAAATTTCACACACACCGCACCAATTCCTCGCAAGCTGAAGACGGTCCGCT
TTACCGACTCATCCTCACCTCCTTCCGATGCCTTGTTCCACCCCTATGAGGACGATCCAATGGACACGTCAAGCG
GTTTACGTGATCAGGCCGGCGGCATGAACAACCAGCAGCTGTACGAGTATCACTCACAAATCCTTGACGCGCAGG
ACGTGCAACTTGATCGCTTGGGCGAGTCAATTAGTCGTCAGAGAGAGCTGAGCCTTCAAATCGGTGATGAGCTAG
ACACTCATGTTGCCATGCTGGATGAGGTTGAGGTTGTGACCGATCGACATCAAAGTCGCTTGGATCGTGCAATGA
AAGCGCTCAAGACAGTGGCCAGGGGAGGCGATGAAAATAAGCAAATGGCCATTATTGTCATCATTGTGATGGCCC
TAATCCTGTTGATCGTGATTCTCAAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail