Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3521
Gene name
LocationContig_1926:3328..4217
Strand+
Gene length (bp)889
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 2.7E-45 31 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 31 226 7.0E-38
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 27 224 2.0E-29
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 35 226 6.0E-26
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 82 216 9.0E-11
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 30 216 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 31 226 7.0E-38
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 27 224 2.0E-29
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 35 226 6.0E-26
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 82 216 9.0E-11
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 30 216 3.0E-10
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 58 216 3.0E-09
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 39 216 2.0E-08
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 82 216 5.0E-08
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 82 216 4.0E-07
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 46 227 7.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 71 215 1.0E-06
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 82 216 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 109 131 22
3 161 180 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3521
MGAFVSWIKDNLDTNNGAPPPDTKPQSISGMISTLVPVLVISALYLLFFLVFRRSQRRYYAPRTYLGSLPHNRRS
PDLPAGWFNWLGTFWKIPDAYALTHQSLDAYLFLRYLRVAMIICFVSLCITWPILFPVNATGKNGQAQLEMLSYS
NINQERESGRFYAHVFVGWAVYGFVMYMIMRECIFYINLRQAYLLAPHYSRRISSRTVLFTAVPSDYLDEARIRQ
MSATRWP*
Coding >Hirsu2|3521
ATGGGGGCCTTCGTCAGCTGGATCAAGGACAACCTCGACACCAACAATGGCGCGCCGCCGCCCGACACGAAGCCC
CAGTCGATATCGGGCATGATCTCGACGCTGGTGCCCGTGCTCGTCATCTCGGCCCTCTACCTGCTCTTCTTCCTC
GTCTTCAGGAGGTCCCAGCGCCGGTACTATGCCCCGAGGACCTACCTCGGCTCCCTGCCGCACAACCGCCGGAGC
CCCGACCTGCCCGCTGGCTGGTTCAACTGGCTCGGCACCTTCTGGAAGATACCGGACGCCTACGCCCTCACCCAC
CAGAGCCTCGACGCCTACCTCTTCCTGCGCTACCTGCGCGTCGCCATGATCATCTGCTTCGTCAGCCTCTGCATC
ACCTGGCCCATCCTCTTCCCCGTCAACGCGACCGGCAAGAACGGCCAGGCCCAGCTCGAGATGCTGTCGTACAGC
AACATCAACCAGGAGCGCGAGTCCGGCCGCTTCTACGCCCACGTCTTCGTCGGCTGGGCCGTCTACGGCTTCGTC
ATGTACATGATCATGCGCGAGTGCATCTTCTACATCAACCTGCGCCAGGCCTACCTGCTCGCCCCCCACTACTCG
CGCCGCATCTCCTCCCGCACCGTCCTCTTCACCGCCGTCCCCTCCGACTACCTCGACGAGGCCCGCATCCGCCAA
ATGAGCGCGACGAGGTGGCCATGA
Transcript >Hirsu2|3521
ATGGGGGCCTTCGTCAGCTGGATCAAGGACAACCTCGACACCAACAATGGCGCGCCGCCGCCCGACACGAAGCCC
CAGTCGATATCGGGCATGATCTCGACGCTGGTGCCCGTGCTCGTCATCTCGGCCCTCTACCTGCTCTTCTTCCTC
GTCTTCAGGAGGTCCCAGCGCCGGTACTATGCCCCGAGGACCTACCTCGGCTCCCTGCCGCACAACCGCCGGAGC
CCCGACCTGCCCGCTGGCTGGTTCAACTGGCTCGGCACCTTCTGGAAGATACCGGACGCCTACGCCCTCACCCAC
CAGAGCCTCGACGCCTACCTCTTCCTGCGCTACCTGCGCGTCGCCATGATCATCTGCTTCGTCAGCCTCTGCATC
ACCTGGCCCATCCTCTTCCCCGTCAACGCGACCGGCAAGAACGGCCAGGCCCAGCTCGAGATGCTGTCGTACAGC
AACATCAACCAGGAGCGCGAGTCCGGCCGCTTCTACGCCCACGTCTTCGTCGGCTGGGCCGTCTACGGCTTCGTC
ATGTACATGATCATGCGCGAGTGCATCTTCTACATCAACCTGCGCCAGGCCTACCTGCTCGCCCCCCACTACTCG
CGCCGCATCTCCTCCCGCACCGTCCTCTTCACCGCCGTCCCCTCCGACTACCTCGACGAGGCCCGCATCCGCCAA
ATGAGCGCGACGAGGTGGCCATGA
Gene >Hirsu2|3521
ATGGGGGCCTTCGTCAGCTGGATCAAGGACAACCTCGACACCAACAATGGCGCGCCGCCGCCCGACACGAAGCCC
CAGTCGATATCGGGTGCGTCTTGTCCCGACGCCCAACATCTCGGCTGACTGTGCGACTGACCGACCGCAGGCATG
ATCTCGACGCTGGTGCCCGTGCTCGTCATCTCGGCCCTCTACCTGCTCTTCTTCCTCGTCTTCAGGAGGTCCCAG
CGCCGGTACTATGCCCCGAGGACCTACCTCGGCTCCCTGCCGCACAAGTAAGCGTCGAGGCCGCCCCGTCCCCCC
CCCCCCCCTCCGGACGCCCGCTGACCGGCTCTCGCCAGCCGCCGGAGCCCCGACCTGCCCGCTGGCTGGTTCAAC
TGGCTCGGCACCTTCTGGAAGATACCGGACGCCTACGCCCTCACCCACCAGAGCCTCGACGCCTACCTCTTCCTG
CGCTACCTGCGCGTCGCCATGATCATCTGCTTCGTCAGCCTCTGCATCACCTGGCCCATCCTCTTCCCCGTCAAC
GCGACCGGCAAGAACGGCCAGGCCCAGCTCGAGATGCTGTCGTACAGCAACATCAACCAGGAGCGCGAGTCCGGC
CGCTTCTACGCCCACGTCTTCGTCGGCTGGGCCGTCTACGGCTTCGTCATGTACATGATCATGCGCGAGTGCATC
TTCTACATCAACCTGCGCCAGGCCTACCTGCTCGCCCCCCACTACTCGCGCCGCATCTCCTCCCGCACCGTCCTC
TTCACCGCCGTCCCCTCCGACTACCTCGACGAGGCCCGCATCCGCCAAATGTTCAACGACTCGGTCCGCCGCGTC
TGGATCGCCGGCAAGGCCGACAAGCTCGACGAGATGGTCGAGGAGCGCGACGAGGTGGCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail