Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3505
Gene name
LocationContig_192:10141..11509
Strand-
Gene length (bp)1368
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 48 67 19
2 150 172 22
3 212 234 22
4 239 261 22
5 290 312 22
6 332 354 22
7 361 383 22
8 398 420 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3505
MVVTTDVFTYIATVAEILNEGLPRAAWSTIGDHSSRSRVQRLRLAKTLILTQAVLGLGMSVVFLGAADGFARAFV
PGEVRRQSVMYVRISSFSALSSALETAVAAAARALDQPDVPLAFSCVKFATNIVLDMLLISTFRVSSAEPTVNMQ
AAIQLACNLTSAFVVLLYFLLSNRGRTGVERHGSTAPALPALMILLRPGITTLIESAVRNALYLWLVSNIISMGA
TYATAWGVFNTIRWGLIMIPVSALEATTLTFVGHNWGRWRRETGRTTVRPRASLQSLYRISRPAFVSVALALAFE
VPICILMSLVGVRPFARYISGSDETAVVTERMWRTMDWCYVIFAATTQLSAVLLATRPKLYLWQSLASNLLYVLP
WAIACHLAHLDESNAWTYHALVSGGSMVFSLFSVLAVLALWAWVLKTGRARLGAVK*
Coding >Hirsu2|3505
ATGGTCGTCACGACGGACGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCG
GCCTGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTG
ACGCAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTC
CCCGGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAG
ACGGCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCC
ACCAACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAG
GCCGCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGC
CGGACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATC
ACCACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCC
ACCTACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAA
GCCACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCT
CGCGCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAG
GTCCCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACG
GCCGTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCC
GCCGTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCC
TGGGCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGT
AGCATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCC
CGCCTGGGCGCAGTCAAGTAG
Transcript >Hirsu2|3505
ATGGTCGTCACGACGGACGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCG
GCCTGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTG
ACGCAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTC
CCCGGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAG
ACGGCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCC
ACCAACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAG
GCCGCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGC
CGGACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATC
ACCACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCC
ACCTACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAA
GCCACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCT
CGCGCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAG
GTCCCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACG
GCCGTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCC
GCCGTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCC
TGGGCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGT
AGCATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCC
CGCCTGGGCGCAGTCAAGTAG
Gene >Hirsu2|3505
ATGGTCGTCACGACGGAGTGAGTGGCTCCGTCGACATCCAGCTCCTCTTCGTGGCACATACGCACGCGGACTGAC
AGTCGGCGCCTCAGCGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCGGCC
TGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTGACG
CAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTCCCC
GGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAGACG
GCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCCACC
AACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAGGCC
GCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGCCGG
ACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATCACC
ACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCCACC
TACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAAGCC
ACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCTCGC
GCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAGGTC
CCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACGGCC
GTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCCGCC
GTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCCTGG
GCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGTAGC
ATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCCCGC
CTGGGCGCAGTCAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail