Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3505
Gene name
LocationContig_192:10141..11509
Strand-
Gene length (bp)1368
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1504 0.1781 0.0958 0.2088 0.1468 0.0448 0.527 0.477 0.4705 0.1246

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 48 67 19
2 150 172 22
3 212 234 22
4 239 261 22
5 290 312 22
6 332 354 22
7 361 383 22
8 398 420 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5138
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3574
Ophiocordyceps australis map64 (Brazil) OphauB2|3109
Ophiocordyceps camponoti-floridani Ophcf2|02784
Ophiocordyceps camponoti-rufipedis Ophun1|4819
Ophiocordyceps kimflemingae Ophio5|4036
Ophiocordyceps subramaniannii Hirsu2|3505 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3505
MVVTTDVFTYIATVAEILNEGLPRAAWSTIGDHSSRSRVQRLRLAKTLILTQAVLGLGMSVVFLGAADGFARAFV
PGEVRRQSVMYVRISSFSALSSALETAVAAAARALDQPDVPLAFSCVKFATNIVLDMLLISTFRVSSAEPTVNMQ
AAIQLACNLTSAFVVLLYFLLSNRGRTGVERHGSTAPALPALMILLRPGITTLIESAVRNALYLWLVSNIISMGA
TYATAWGVFNTIRWGLIMIPVSALEATTLTFVGHNWGRWRRETGRTTVRPRASLQSLYRISRPAFVSVALALAFE
VPICILMSLVGVRPFARYISGSDETAVVTERMWRTMDWCYVIFAATTQLSAVLLATRPKLYLWQSLASNLLYVLP
WAIACHLAHLDESNAWTYHALVSGGSMVFSLFSVLAVLALWAWVLKTGRARLGAVK*
Coding >Hirsu2|3505
ATGGTCGTCACGACGGACGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCG
GCCTGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTG
ACGCAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTC
CCCGGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAG
ACGGCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCC
ACCAACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAG
GCCGCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGC
CGGACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATC
ACCACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCC
ACCTACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAA
GCCACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCT
CGCGCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAG
GTCCCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACG
GCCGTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCC
GCCGTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCC
TGGGCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGT
AGCATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCC
CGCCTGGGCGCAGTCAAGTAG
Transcript >Hirsu2|3505
ATGGTCGTCACGACGGACGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCG
GCCTGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTG
ACGCAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTC
CCCGGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAG
ACGGCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCC
ACCAACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAG
GCCGCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGC
CGGACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATC
ACCACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCC
ACCTACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAA
GCCACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCT
CGCGCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAG
GTCCCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACG
GCCGTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCC
GCCGTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCC
TGGGCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGT
AGCATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCC
CGCCTGGGCGCAGTCAAGTAG
Gene >Hirsu2|3505
ATGGTCGTCACGACGGAGTGAGTGGCTCCGTCGACATCCAGCTCCTCTTCGTGGCACATACGCACGCGGACTGAC
AGTCGGCGCCTCAGCGTATTCACGTACATCGCAACCGTCGCCGAGATCCTCAACGAGGGCCTCCCCCGAGCGGCC
TGGTCCACCATCGGCGACCACTCCTCCCGCAGCCGGGTCCAGCGGCTGCGGCTGGCCAAGACGCTGATCCTGACG
CAGGCCGTCCTCGGCCTCGGCATGTCCGTCGTCTTCCTCGGCGCCGCCGACGGCTTCGCCCGGGCCTTCGTCCCC
GGCGAGGTGCGCCGGCAGAGCGTCATGTACGTCCGCATCAGCAGCTTCTCGGCCCTCAGCAGCGCGCTCGAGACG
GCCGTCGCGGCGGCGGCCAGGGCGCTGGACCAGCCCGACGTGCCGCTGGCGTTTAGCTGCGTCAAGTTCGCCACC
AACATCGTACTCGACATGCTGCTCATCTCGACCTTTAGAGTCTCGTCCGCCGAGCCGACGGTCAACATGCAGGCC
GCCATCCAGCTGGCCTGCAACCTGACCTCTGCCTTCGTCGTCCTCCTCTACTTCTTGCTCTCGAACCGGGGCCGG
ACAGGAGTGGAGCGGCACGGGAGCACGGCGCCAGCTTTGCCGGCTCTGATGATCTTGCTCCGCCCCGGCATCACC
ACCCTCATCGAGTCGGCCGTCCGGAACGCCCTCTACCTCTGGCTGGTGAGCAACATCATCTCCATGGGCGCCACC
TACGCCACCGCCTGGGGCGTCTTCAACACGATCCGCTGGGGCCTCATCATGATACCCGTCTCGGCCCTCGAAGCC
ACCACCTTGACCTTCGTCGGACACAATTGGGGCCGGTGGCGGCGCGAGACGGGCAGGACCACGGTCCGGCCTCGC
GCGAGCCTCCAGTCCCTCTATCGGATCTCGCGCCCGGCCTTCGTGTCCGTTGCCCTGGCGCTCGCCTTCGAGGTC
CCCATCTGCATCCTCATGTCCCTCGTGGGCGTCCGCCCCTTCGCCCGCTACATCAGCGGCAGCGACGAGACGGCC
GTCGTGACGGAGCGCATGTGGAGGACGATGGACTGGTGCTACGTCATCTTCGCCGCCACGACCCAGCTGTCCGCC
GTCCTGCTTGCGACGAGACCCAAGTTGTACCTGTGGCAGAGCCTGGCCAGCAACTTGCTCTACGTCCTGCCCTGG
GCCATTGCTTGCCATCTCGCCCATCTGGACGAGAGCAATGCCTGGACGTACCACGCGCTTGTCTCGGGCGGTAGC
ATGGTCTTCAGCCTCTTCAGTGTGCTCGCCGTCCTGGCCTTGTGGGCCTGGGTGTTGAAGACCGGCAGAGCCCGC
CTGGGCGCAGTCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail