Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3501
Gene name
LocationContig_1919:371..3546
Strand+
Gene length (bp)3175
Transcript length (bp)2985
Coding sequence length (bp)2985
Protein length (aa) 995

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 6.6E-34 484 694
PF11987 IF-2 Translation-initiation factor 2 3.5E-19 829 920
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 7.5E-08 721 797
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.3E-05 485 608

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 236 994 0.0E+00
sp|P39730|IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 152 994 0.0E+00
sp|Q54XP6|IF2P_DICDI Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 479 980 0.0E+00
sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 480 980 0.0E+00
sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 480 980 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 236 994 0.0E+00
sp|P39730|IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 152 994 0.0E+00
sp|Q54XP6|IF2P_DICDI Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 479 980 0.0E+00
sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 480 980 0.0E+00
sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 480 980 0.0E+00
sp|A8A8D3|IF2P_IGNH4 Probable translation initiation factor IF-2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=infB PE=3 SV=1 472 974 1.0E-120
sp|A1RXH6|IF2P_THEPD Probable translation initiation factor IF-2 OS=Thermofilum pendens (strain Hrk 5) GN=infB PE=3 SV=1 480 974 8.0E-116
sp|Q9Y9B3|IF2P_AERPE Probable translation initiation factor IF-2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=infB PE=3 SV=1 479 974 1.0E-113
sp|Q2FU48|IF2P_METHJ Probable translation initiation factor IF-2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=infB PE=3 SV=1 479 969 7.0E-110
sp|C6A1V3|IF2P_THESM Probable translation initiation factor IF-2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=infB PE=3 SV=1 480 974 7.0E-110
sp|P95691|IF2P_SULAC Probable translation initiation factor IF-2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=infB PE=3 SV=2 480 969 8.0E-110
sp|A0B8Q6|IF2P_METTP Probable translation initiation factor IF-2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=infB PE=3 SV=1 455 974 1.0E-109
sp|A3DMS0|IF2P_STAMF Probable translation initiation factor IF-2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=infB PE=3 SV=1 477 974 2.0E-109
sp|A2BJZ8|IF2P_HYPBU Probable translation initiation factor IF-2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=infB PE=3 SV=1 476 974 4.0E-109
sp|Q9HNQ2|IF2P_HALSA Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=infB PE=3 SV=1 479 980 5.0E-108
sp|B0R6U5|IF2P_HALS3 Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=infB PE=3 SV=1 479 980 5.0E-108
sp|B6YWH3|IF2P_THEON Probable translation initiation factor IF-2 OS=Thermococcus onnurineus (strain NA1) GN=infB PE=3 SV=1 480 969 6.0E-108
sp|Q466D5|IF2P_METBF Probable translation initiation factor IF-2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=infB PE=3 SV=1 477 969 2.0E-107
sp|A2STM8|IF2P_METLZ Probable translation initiation factor IF-2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=infB PE=3 SV=1 477 975 3.0E-107
sp|Q8PU78|IF2P_METMA Probable translation initiation factor IF-2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=infB PE=3 SV=1 477 956 7.0E-107
sp|A4YCQ5|IF2P_METS5 Probable translation initiation factor IF-2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=infB PE=3 SV=1 474 958 5.0E-106
sp|Q8TQL5|IF2P_METAC Probable translation initiation factor IF-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=infB PE=3 SV=1 471 947 2.0E-104
sp|Q0W8X2|IF2P_METAR Probable translation initiation factor IF-2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=infB PE=3 SV=1 471 969 2.0E-104
sp|A3CSP4|IF2P_METMJ Probable translation initiation factor IF-2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=infB PE=3 SV=1 479 969 3.0E-104
sp|O26359|IF2P_METTH Probable translation initiation factor IF-2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=infB PE=1 SV=1 480 974 1.0E-102
sp|Q976A1|IF2P_SULTO Probable translation initiation factor IF-2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=infB PE=3 SV=1 480 974 1.0E-102
sp|A6UVG0|IF2P_META3 Probable translation initiation factor IF-2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=infB PE=3 SV=1 480 975 2.0E-102
sp|Q12Z93|IF2P_METBU Probable translation initiation factor IF-2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=infB PE=3 SV=1 477 976 1.0E-100
sp|Q2NGM6|IF2P_METST Probable translation initiation factor IF-2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=infB PE=3 SV=1 481 966 4.0E-100
sp|A4FZQ3|IF2P_METM5 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=infB PE=3 SV=1 480 976 5.0E-100
sp|O29490|IF2P_ARCFU Probable translation initiation factor IF-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=infB PE=3 SV=1 480 979 1.0E-99
sp|A7IAP7|IF2P_METB6 Probable translation initiation factor IF-2 OS=Methanoregula boonei (strain 6A8) GN=infB PE=3 SV=1 476 972 2.0E-99
sp|A8MBV9|IF2P_CALMQ Probable translation initiation factor IF-2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=infB PE=3 SV=1 478 969 3.0E-99
sp|A9A813|IF2P_METM6 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=infB PE=3 SV=1 480 987 4.0E-99
sp|Q5UXU6|IF2P_HALMA Probable translation initiation factor IF-2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=infB PE=3 SV=1 480 969 4.0E-99
sp|A6VIS4|IF2P_METM7 Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=infB PE=3 SV=1 480 976 1.0E-98
sp|B9LQL7|IF2P_HALLT Probable translation initiation factor IF-2 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=infB PE=3 SV=1 476 969 5.0E-97
sp|Q18FT0|IF2P_HALWD Probable translation initiation factor IF-2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=infB PE=3 SV=3 478 969 6.0E-97
sp|Q6M0I6|IF2P_METMP Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain S2 / LL) GN=infB PE=3 SV=1 480 976 2.0E-96
sp|A5UJM9|IF2P_METS3 Probable translation initiation factor IF-2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=infB PE=3 SV=1 480 969 4.0E-96
sp|A1RUX2|IF2P_PYRIL Probable translation initiation factor IF-2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=infB PE=3 SV=1 479 969 2.0E-95
sp|Q8ZX20|IF2P_PYRAE Probable translation initiation factor IF-2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=infB PE=3 SV=1 479 969 6.0E-95
sp|Q5JGR9|IF2P_THEKO Probable translation initiation factor IF-2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=infB PE=3 SV=1 496 969 1.0E-94
sp|A3MTU7|IF2P_PYRCJ Probable translation initiation factor IF-2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=infB PE=3 SV=1 480 969 1.0E-93
sp|B1YCQ7|IF2P_PYRNV Probable translation initiation factor IF-2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=infB PE=3 SV=1 480 969 1.0E-93
sp|A6URS1|IF2P_METVS Probable translation initiation factor IF-2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=infB PE=3 SV=1 480 987 2.0E-93
sp|A4WIK2|IF2P_PYRAR Probable translation initiation factor IF-2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=infB PE=3 SV=1 479 969 3.0E-93
sp|Q980Q8|IF2P_SULSO Probable translation initiation factor IF-2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=infB PE=3 SV=1 474 974 2.0E-92
sp|Q8U1R8|IF2P_PYRFU Probable translation initiation factor IF-2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=infB PE=3 SV=1 496 969 1.0E-91
sp|Q9UZK7|IF2P_PYRAB Probable translation initiation factor IF-2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=infB PE=3 SV=1 496 969 2.0E-91
sp|Q8TV06|IF2P_METKA Probable translation initiation factor IF-2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=infB PE=3 SV=1 474 974 1.0E-90
sp|O58822|IF2P_PYRHO Probable translation initiation factor IF-2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=infB PE=3 SV=1 496 969 1.0E-90
sp|Q3IMS5|IF2P_NATPD Probable translation initiation factor IF-2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=infB PE=3 SV=1 480 991 8.0E-89
sp|Q57710|IF2P_METJA Probable translation initiation factor IF-2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=infB PE=3 SV=1 496 974 3.0E-83
sp|Q9HJ60|IF2P_THEAC Probable translation initiation factor IF-2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=infB PE=3 SV=1 480 970 6.0E-78
sp|Q97BK4|IF2P_THEVO Probable translation initiation factor IF-2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=infB PE=3 SV=1 480 970 4.0E-76
sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 481 929 6.0E-39
sp|A1AV99|IF2_RUTMC Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 481 918 8.0E-38
sp|A5WBS5|IF2_PSYWF Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 475 928 3.0E-37
sp|Q0BK70|IF2_FRATO Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 481 980 2.0E-36
sp|A7NEI8|IF2_FRATF Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 481 980 2.0E-36
sp|A5CXX6|IF2_VESOH Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 481 978 2.0E-36
sp|Q2A1G8|IF2_FRATH Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 481 980 2.0E-36
sp|A0Q8F3|IF2_FRATN Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 481 980 3.0E-36
sp|A4IW10|IF2_FRATW Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 481 980 3.0E-36
sp|B2SEW7|IF2_FRATM Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 481 980 4.0E-36
sp|A6QBQ5|IF2_SULNB Translation initiation factor IF-2 OS=Sulfurovum sp. (strain NBC37-1) GN=infB PE=3 SV=1 481 918 4.0E-36
sp|Q5NIL7|IF2_FRATT Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 481 980 5.0E-36
sp|Q14K20|IF2_FRAT1 Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 481 980 5.0E-36
sp|A7GZZ3|IF2_CAMC5 Translation initiation factor IF-2 OS=Campylobacter curvus (strain 525.92) GN=infB PE=3 SV=1 474 918 6.0E-36
sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 481 993 7.0E-36
sp|Q04GN0|IF2_OENOB Translation initiation factor IF-2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=infB PE=3 SV=1 481 978 1.0E-35
sp|Q9ZF25|IF2_ENTCL Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 481 993 1.0E-35
sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 476 929 1.0E-35
sp|B0VE81|IF2_ACIBY Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 469 918 1.0E-35
sp|B2I2M7|IF2_ACIBC Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 469 918 1.0E-35
sp|B7I3R9|IF2_ACIB5 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 469 918 1.0E-35
sp|B7H115|IF2_ACIB3 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 469 918 1.0E-35
sp|C3L0B6|IF2_CLOB6 Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 481 928 2.0E-35
sp|B0VLU2|IF2_ACIBS Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 469 918 2.0E-35
sp|B1KWK7|IF2_CLOBM Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 481 928 2.0E-35
sp|A0LHL8|IF2_SYNFM Translation initiation factor IF-2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=infB PE=3 SV=1 481 929 3.0E-35
sp|A3QGU5|IF2_SHELP Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 481 993 3.0E-35
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 481 928 3.0E-35
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 481 928 3.0E-35
sp|B1L7T1|IF2_THESQ Translation initiation factor IF-2 OS=Thermotoga sp. (strain RQ2) GN=infB PE=3 SV=1 462 929 4.0E-35
sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 480 978 5.0E-35
sp|C1FS59|IF2_CLOBJ Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 481 928 5.0E-35
sp|B1II49|IF2_CLOBK Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 481 928 5.0E-35
sp|A1ST45|IF2_PSYIN Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 481 980 6.0E-35
sp|Q74IS8|IF2_LACJO Translation initiation factor IF-2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=infB PE=3 SV=1 481 929 6.0E-35
sp|A7ZC69|IF2_CAMC1 Translation initiation factor IF-2 OS=Campylobacter concisus (strain 13826) GN=infB PE=3 SV=1 462 918 7.0E-35
sp|Q044B7|IF2_LACGA Translation initiation factor IF-2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=infB PE=3 SV=1 481 929 7.0E-35
sp|A5IJ09|IF2_THEP1 Translation initiation factor IF-2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=infB PE=3 SV=1 462 929 9.0E-35
sp|Q7M7X5|IF2_WOLSU Translation initiation factor IF-2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=infB PE=3 SV=1 481 918 9.0E-35
sp|Q4FVL5|IF2_PSYA2 Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 481 993 1.0E-34
sp|Q7MI09|IF2_VIBVY Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 477 993 1.0E-34
sp|Q1QEP5|IF2_PSYCK Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 469 993 1.0E-34
sp|A9BJ54|IF2_PETMO Translation initiation factor IF-2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=infB PE=3 SV=1 475 935 1.0E-34
sp|A8YVQ7|IF2_LACH4 Translation initiation factor IF-2 OS=Lactobacillus helveticus (strain DPC 4571) GN=infB PE=3 SV=1 481 929 1.0E-34
sp|Q6FF40|IF2_ACIAD Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 469 918 1.0E-34
sp|C5BFB7|IF2_EDWI9 Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 481 993 1.0E-34
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 481 993 1.0E-34
sp|Q8DBW0|IF2_VIBVU Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 477 993 1.0E-34
sp|C3LSP8|IF2_VIBCM Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 481 993 2.0E-34
sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 481 993 2.0E-34
sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 481 993 2.0E-34
sp|B7IF03|IF2_THEAB Translation initiation factor IF-2 OS=Thermosipho africanus (strain TCF52B) GN=infB PE=3 SV=1 481 929 2.0E-34
sp|A8FYS0|IF2_SHESH Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 481 993 2.0E-34
sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 468 993 2.0E-34
sp|P44323|IF2_HAEIN Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 481 993 3.0E-34
sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 481 918 3.0E-34
sp|Q9WZN3|IF2_THEMA Translation initiation factor IF-2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=infB PE=3 SV=1 462 929 3.0E-34
sp|B1KRR0|IF2_SHEWM Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 481 993 3.0E-34
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 481 993 3.0E-34
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 481 993 4.0E-34
sp|C0QTL9|IF2_PERMH Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 481 993 4.0E-34
sp|A5UBT6|IF2_HAEIE Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 481 993 4.0E-34
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 469 993 4.0E-34
sp|A4SJR5|IF2_AERS4 Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 481 993 4.0E-34
sp|Q6MD64|IF2_PARUW Translation initiation factor IF-2 OS=Protochlamydia amoebophila (strain UWE25) GN=infB PE=3 SV=1 480 994 5.0E-34
sp|Q5FJN6|IF2_LACAC Translation initiation factor IF-2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=infB PE=3 SV=1 475 993 6.0E-34
sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 481 993 6.0E-34
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 481 993 6.0E-34
sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 481 993 6.0E-34
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 481 993 7.0E-34
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 481 993 7.0E-34
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 481 993 8.0E-34
sp|A8MFA8|IF2_ALKOO Translation initiation factor IF-2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=infB PE=3 SV=1 481 929 9.0E-34
sp|Q4QK37|IF2_HAEI8 Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 481 993 1.0E-33
sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=infB PE=3 SV=1 481 928 1.0E-33
sp|A5UF34|IF2_HAEIG Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 481 993 1.0E-33
sp|Q0A797|IF2_ALKEH Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 481 993 1.0E-33
sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 481 941 1.0E-33
sp|Q038M5|IF2_LACC3 Translation initiation factor IF-2 OS=Lactobacillus casei (strain ATCC 334) GN=infB PE=3 SV=1 475 934 2.0E-33
sp|A0KTZ6|IF2_SHESA Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 481 993 2.0E-33
sp|B3WER5|IF2_LACCB Translation initiation factor IF-2 OS=Lactobacillus casei (strain BL23) GN=infB PE=3 SV=1 475 934 2.0E-33
sp|B0TWR3|IF2_FRAP2 Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 481 980 2.0E-33
sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 481 993 2.0E-33
sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 481 993 2.0E-33
sp|A6LP48|IF2_THEM4 Translation initiation factor IF-2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=infB PE=3 SV=1 481 929 2.0E-33
sp|B3H163|IF2_ACTP7 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 481 993 3.0E-33
sp|A3N005|IF2_ACTP2 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 481 993 3.0E-33
sp|Q5QTY8|IF2_IDILO Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 481 993 4.0E-33
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 481 993 4.0E-33
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 481 993 4.0E-33
sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 468 993 5.0E-33
sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 480 934 5.0E-33
sp|Q8EHL5|IF2_SHEON Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 481 993 5.0E-33
sp|B7GG75|IF2_ANOFW Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 481 934 6.0E-33
sp|Q609C0|IF2_METCA Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 481 980 6.0E-33
sp|B6ENE2|IF2_ALISL Translation initiation factor IF-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=infB PE=3 SV=1 481 993 6.0E-33
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 480 978 6.0E-33
sp|B0UU13|IF2_HISS2 Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 481 993 6.0E-33
sp|Q0I3P5|IF2_HAES1 Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 481 993 7.0E-33
sp|A8F5A0|IF2_PSELT Translation initiation factor IF-2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=infB PE=3 SV=1 462 991 8.0E-33
sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 481 993 9.0E-33
sp|Q0K9B9|IF2_CUPNH Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 481 993 9.0E-33
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 422 993 9.0E-33
sp|P57873|IF2_PASMU Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 481 993 1.0E-32
sp|Q88VK7|IF2_LACPL Translation initiation factor IF-2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=infB PE=3 SV=1 476 978 1.0E-32
sp|A8G907|IF2_SERP5 Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 481 993 1.0E-32
sp|P17889|IF2_BACSU Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 480 934 1.0E-32
sp|A6VNE0|IF2_ACTSZ Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 481 993 1.0E-32
sp|A1U600|IF2_MARHV Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 481 993 1.0E-32
sp|A6VU29|IF2_MARMS Translation initiation factor IF-2 OS=Marinomonas sp. (strain MWYL1) GN=infB PE=3 SV=1 481 993 1.0E-32
sp|A5VTB2|IF2_BRUO2 Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 481 980 1.0E-32
sp|Q03FS3|IF2_PEDPA Translation initiation factor IF-2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=infB PE=3 SV=1 481 929 1.0E-32
sp|Q31LL9|IF2_SYNE7 Translation initiation factor IF-2 OS=Synechococcus elongatus (strain PCC 7942) GN=infB PE=3 SV=1 481 929 1.0E-32
sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 481 937 1.0E-32
sp|B8CKH3|IF2_SHEPW Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 468 993 2.0E-32
sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|B8E6N2|IF2_SHEB2 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|A1A0A2|IF2_BIFAA Translation initiation factor IF-2 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=infB PE=3 SV=1 481 935 2.0E-32
sp|B3R1E4|IF2_CUPTR Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|A9M9Z4|IF2_BRUC2 Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 481 980 2.0E-32
sp|Q5GS99|IF2_WOLTR Translation initiation factor IF-2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=infB PE=3 SV=1 481 980 2.0E-32
sp|Q482T9|IF2_COLP3 Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 469 993 2.0E-32
sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|Q89AF5|IF2_BUCBP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 481 993 2.0E-32
sp|B0CK11|IF2_BRUSI Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 481 980 3.0E-32
sp|Q57AA0|IF2_BRUAB Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 481 980 3.0E-32
sp|Q2YQR7|IF2_BRUA2 Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 481 980 3.0E-32
sp|B9KEV0|IF2_CAMLR Translation initiation factor IF-2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=infB PE=3 SV=1 475 918 3.0E-32
sp|Q30WJ0|IF2_DESAG Translation initiation factor IF-2 OS=Desulfovibrio alaskensis (strain G20) GN=infB PE=3 SV=1 481 928 3.0E-32
sp|Q1QSZ0|IF2_CHRSD Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 481 993 3.0E-32
sp|Q8FXT2|IF2_BRUSU Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 481 980 3.0E-32
sp|C5CDZ4|IF2_KOSOT Translation initiation factor IF-2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=infB PE=3 SV=1 433 934 3.0E-32
sp|Q01W31|IF2_SOLUE Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 481 928 3.0E-32
sp|Q8YEB3|IF2_BRUME Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 481 980 3.0E-32
sp|B9DPF5|IF2_STACT Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 481 934 3.0E-32
sp|A6WWW5|IF2_OCHA4 Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 481 980 4.0E-32
sp|B0BNR5|IF2_ACTPJ Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 481 993 4.0E-32
sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 481 993 5.0E-32
sp|Q87M02|IF2_VIBPA Translation initiation factor IF-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=infB PE=3 SV=1 481 993 5.0E-32
sp|B1HR05|IF2_LYSSC Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 481 980 5.0E-32
sp|B2GKR5|IF2_KOCRD Translation initiation factor IF-2 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=infB PE=3 SV=1 470 937 6.0E-32
sp|C4Z5N7|IF2_EUBE2 Translation initiation factor IF-2 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=infB PE=3 SV=1 481 991 6.0E-32
sp|B0K9Q0|IF2_THEP3 Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 481 937 6.0E-32
sp|B0K1D6|IF2_THEPX Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 481 937 7.0E-32
sp|Q1LLR6|IF2_CUPMC Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 481 993 7.0E-32
sp|Q0VSS1|IF2_ALCBS Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 481 993 7.0E-32
sp|A0RQZ4|IF2_CAMFF Translation initiation factor IF-2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=infB PE=3 SV=1 481 918 7.0E-32
sp|A7Z4T4|IF2_BACMF Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 480 934 8.0E-32
sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 481 980 8.0E-32
sp|Q30SS6|IF2_SULDN Translation initiation factor IF-2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=infB PE=3 SV=1 481 918 8.0E-32
sp|Q73FL0|IF2_WOLPM Translation initiation factor IF-2 OS=Wolbachia pipientis wMel GN=infB PE=3 SV=1 481 978 8.0E-32
sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 481 993 9.0E-32
sp|B7KIU2|IF2_CYAP7 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7424) GN=infB PE=3 SV=1 472 943 9.0E-32
sp|A7HN01|IF2_FERNB Translation initiation factor IF-2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=infB PE=3 SV=1 476 929 9.0E-32
sp|B4RXT8|IF2_ALTMD Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 481 993 1.0E-31
sp|Q895J8|IF2_CLOTE Translation initiation factor IF-2 OS=Clostridium tetani (strain Massachusetts / E88) GN=infB PE=3 SV=1 445 929 1.0E-31
sp|Q3J9B6|IF2_NITOC Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 476 980 1.0E-31
sp|A8M746|IF2_SALAI Translation initiation factor IF-2 OS=Salinispora arenicola (strain CNS-205) GN=infB PE=3 SV=1 481 937 1.0E-31
sp|P72689|IF2_SYNY3 Translation initiation factor IF-2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=infB PE=3 SV=1 478 943 1.0E-31
sp|A7I3V0|IF2_CAMHC Translation initiation factor IF-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=infB PE=3 SV=1 481 918 1.0E-31
sp|B1XI09|IF2_SYNP2 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=infB PE=3 SV=1 481 943 2.0E-31
sp|Q1GVI9|IF2_SPHAL Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 481 916 2.0E-31
sp|A4X4N7|IF2_SALTO Translation initiation factor IF-2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=infB PE=3 SV=1 481 937 2.0E-31
sp|Q8RA37|IF2_CALS4 Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 481 937 2.0E-31
sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 481 929 2.0E-31
sp|B8JFY6|IF2_ANAD2 Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 476 929 2.0E-31
sp|A1VG83|IF2_DESVV Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 481 928 2.0E-31
sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 481 928 2.0E-31
sp|Q049V5|IF2_LACDB Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=infB PE=3 SV=1 480 929 2.0E-31
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 481 936 2.0E-31
sp|A1WXV1|IF2_HALHL Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 481 929 3.0E-31
sp|Q6LUJ2|IF2_PHOPR Translation initiation factor IF-2 OS=Photobacterium profundum GN=infB PE=3 SV=1 481 993 3.0E-31
sp|Q5N0A5|IF2_SYNP6 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=infB PE=3 SV=1 483 929 3.0E-31
sp|Q6YR66|IF2_ONYPE Translation initiation factor IF-2 OS=Onion yellows phytoplasma (strain OY-M) GN=infB PE=3 SV=1 481 935 3.0E-31
sp|Q2KXY7|IF2_BORA1 Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 481 993 3.0E-31
sp|Q0SSD4|IF2_CLOPS Translation initiation factor IF-2 OS=Clostridium perfringens (strain SM101 / Type A) GN=infB PE=3 SV=1 481 928 3.0E-31
sp|B0RDY9|IF2_CLAMS Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=infB PE=3 SV=1 480 936 3.0E-31
sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 481 929 3.0E-31
sp|A6TRK7|IF2_ALKMQ Translation initiation factor IF-2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=infB PE=3 SV=1 481 993 3.0E-31
sp|B4UHG0|IF2_ANASK Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 476 929 3.0E-31
sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 481 937 3.0E-31
sp|Q8XJR8|IF2_CLOPE Translation initiation factor IF-2 OS=Clostridium perfringens (strain 13 / Type A) GN=infB PE=3 SV=1 481 928 3.0E-31
sp|Q0TPR7|IF2_CLOP1 Translation initiation factor IF-2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=infB PE=3 SV=1 481 928 3.0E-31
sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 481 993 3.0E-31
sp|Q1G9P9|IF2_LACDA Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=infB PE=3 SV=1 480 929 3.0E-31
sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 481 993 4.0E-31
sp|B8HUA9|IF2_CYAP4 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 472 994 4.0E-31
sp|Q493T7|IF2_BLOPB Translation initiation factor IF-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=infB PE=3 SV=1 481 993 4.0E-31
sp|B3PI96|IF2_CELJU Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 465 993 4.0E-31
sp|A5CSZ4|IF2_CLAM3 Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=infB PE=3 SV=1 480 936 4.0E-31
sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 481 993 5.0E-31
sp|B8CW72|IF2_HALOH Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 480 929 5.0E-31
sp|B1MZH4|IF2_LEUCK Translation initiation factor IF-2 OS=Leuconostoc citreum (strain KM20) GN=infB PE=3 SV=1 481 993 5.0E-31
sp|Q9KA77|IF2_BACHD Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 481 978 6.0E-31
sp|B2JKT4|IF2_BURP8 Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 481 993 6.0E-31
sp|Q9PGR3|IF2_XYLFA Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 481 993 7.0E-31
sp|Q2IPZ7|IF2_ANADE Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 476 929 7.0E-31
sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 481 969 7.0E-31
sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 481 980 7.0E-31
sp|Q7VQM3|IF2_BLOFL Translation initiation factor IF-2 OS=Blochmannia floridanus GN=infB PE=3 SV=1 481 979 7.0E-31
sp|Q39H30|IF2_BURL3 Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 481 993 8.0E-31
sp|P04766|IF2_GEOSE Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 481 993 8.0E-31
sp|A5EWY9|IF2_DICNV Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 480 993 9.0E-31
sp|C1F697|IF2_ACIC5 Translation initiation factor IF-2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=infB PE=3 SV=1 467 928 9.0E-31
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 481 993 9.0E-31
sp|Q03WH4|IF2_LEUMM Translation initiation factor IF-2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=infB PE=3 SV=1 481 993 9.0E-31
sp|A0K6X5|IF2_BURCH Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 481 993 9.0E-31
sp|Q1BWS7|IF2_BURCA Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 481 993 9.0E-31
sp|C5D9C9|IF2_GEOSW Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|B1K0M0|IF2_BURCC Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 481 929 1.0E-30
sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 481 929 1.0E-30
sp|Q9PIZ1|IF2_CAMJE Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=infB PE=3 SV=1 481 918 1.0E-30
sp|A1JIW9|IF2_YERE8 Translation initiation factor IF-2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|B8GP02|IF2_THISH Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|Q65SK9|IF2_MANSM Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|Q6AG49|IF2_LEIXX Translation initiation factor IF-2 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=infB PE=3 SV=1 480 936 1.0E-30
sp|Q5YSC6|IF2_NOCFA Translation initiation factor IF-2 OS=Nocardia farcinica (strain IFM 10152) GN=infB PE=3 SV=2 480 937 1.0E-30
sp|Q11BC8|IF2_CHESB Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 481 980 1.0E-30
sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|Q8K9H1|IF2_BUCAP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 481 993 1.0E-30
sp|A9BCI5|IF2_PROM4 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 477 969 1.0E-30
sp|A8FJU1|IF2_CAMJ8 Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=infB PE=3 SV=1 481 918 2.0E-30
sp|Q46ZP1|IF2_CUPPJ Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 481 932 2.0E-30
sp|A6MVX8|IF2C_RHDSA Translation initiation factor IF-2, chloroplastic OS=Rhodomonas salina GN=infB PE=3 SV=1 481 994 2.0E-30
sp|Q2JMD7|IF2_SYNJB Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=infB PE=3 SV=1 481 918 2.0E-30
sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 481 969 2.0E-30
sp|B4E7L1|IF2_BURCJ Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|O83861|IF2_TREPA Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|Q5HX30|IF2_CAMJR Translation initiation factor IF-2 OS=Campylobacter jejuni (strain RM1221) GN=infB PE=3 SV=1 481 918 2.0E-30
sp|Q83GT8|IF2_TROWT Translation initiation factor IF-2 OS=Tropheryma whipplei (strain Twist) GN=infB PE=3 SV=1 480 937 2.0E-30
sp|B2A397|IF2_NATTJ Translation initiation factor IF-2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=infB PE=3 SV=1 481 914 2.0E-30
sp|Q5HB61|IF2_EHRRW Translation initiation factor IF-2 OS=Ehrlichia ruminantium (strain Welgevonden) GN=infB PE=3 SV=1 481 980 2.0E-30
sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 481 969 2.0E-30
sp|Q83HG7|IF2_TROW8 Translation initiation factor IF-2 OS=Tropheryma whipplei (strain TW08/27) GN=infB PE=3 SV=1 480 937 2.0E-30
sp|Q82WD0|IF2_NITEU Translation initiation factor IF-2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|Q7VYR2|IF2_BORPE Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 481 980 2.0E-30
sp|Q03QT5|IF2_LACBA Translation initiation factor IF-2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=infB PE=3 SV=1 394 929 2.0E-30
sp|Q2SVG8|IF2_BURTA Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|Q15V72|IF2_PSEA6 Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|B0U1Q8|IF2_XYLFM Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 481 993 2.0E-30
sp|Q9PKU0|IF2_CHLMU Translation initiation factor IF-2 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=infB PE=3 SV=1 480 929 2.0E-30
sp|Q086H2|IF2_SHEFN Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 481 993 3.0E-30
sp|B3PXE3|IF2_RHIE6 Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 481 980 3.0E-30
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 481 980 3.0E-30
sp|B8DW43|IF2_BIFA0 Translation initiation factor IF-2 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=infB PE=3 SV=1 481 935 3.0E-30
sp|Q87EV4|IF2_XYLFT Translation initiation factor IF-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=infB PE=3 SV=1 481 993 4.0E-30
sp|B2I726|IF2_XYLF2 Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M23) GN=infB PE=3 SV=1 481 993 4.0E-30
sp|Q1IIT3|IF2_KORVE Translation initiation factor IF-2 OS=Koribacter versatilis (strain Ellin345) GN=infB PE=3 SV=1 480 993 4.0E-30
sp|B5XSX4|IF2_KLEP3 Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 481 993 4.0E-30
sp|Q5X1C3|IF2_LEGPA Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 471 980 4.0E-30
sp|Q1MQY8|IF2_LAWIP Translation initiation factor IF-2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=infB PE=3 SV=1 481 928 4.0E-30
sp|A1VXL9|IF2_CAMJJ Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=infB PE=3 SV=1 481 918 4.0E-30
sp|A9KNW4|IF2_CLOPH Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 481 929 4.0E-30
sp|B9EBE9|IF2_MACCJ Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 481 929 4.0E-30
sp|P55875|IF2_STIAU Translation initiation factor IF-2 OS=Stigmatella aurantiaca GN=infB PE=3 SV=1 472 937 4.0E-30
sp|Q17WQ8|IF2_HELAH Translation initiation factor IF-2 OS=Helicobacter acinonychis (strain Sheeba) GN=infB PE=3 SV=1 481 918 4.0E-30
sp|A6TEI7|IF2_KLEP7 Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 481 993 4.0E-30
sp|B8FCY5|IF2_DESAA Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 481 929 4.0E-30
sp|Q6AJY4|IF2_DESPS Translation initiation factor IF-2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=infB PE=3 SV=1 481 929 4.0E-30
sp|A7H1L5|IF2_CAMJD Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=infB PE=3 SV=1 481 918 4.0E-30
sp|Q9ZM46|IF2_HELPJ Translation initiation factor IF-2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=infB PE=3 SV=1 481 920 4.0E-30
sp|A3NUL0|IF2_BURP0 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 481 993 5.0E-30
sp|Q1CUA6|IF2_HELPH Translation initiation factor IF-2 OS=Helicobacter pylori (strain HPAG1) GN=infB PE=3 SV=1 481 918 5.0E-30
sp|Q63TP8|IF2_BURPS Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 481 993 5.0E-30
sp|A3N8V8|IF2_BURP6 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 481 993 5.0E-30
sp|Q3JSY9|IF2_BURP1 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 481 993 5.0E-30
sp|Q2RMS0|IF2_RHORT Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 481 980 6.0E-30
sp|Q5ZRV4|IF2_LEGPH Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 471 980 6.0E-30
sp|B6JKX5|IF2_HELP2 Translation initiation factor IF-2 OS=Helicobacter pylori (strain P12) GN=infB PE=3 SV=1 481 918 6.0E-30
sp|A4JDX1|IF2_BURVG Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 481 993 6.0E-30
sp|B5Z6E6|IF2_HELPG Translation initiation factor IF-2 OS=Helicobacter pylori (strain G27) GN=infB PE=3 SV=1 481 918 7.0E-30
sp|Q6G0P2|IF2_BARQU Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 481 980 7.0E-30
sp|Q3Z7U3|IF2_DEHM1 Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=infB PE=3 SV=1 480 929 7.0E-30
sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 481 993 7.0E-30
sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 481 993 7.0E-30
sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 481 993 7.0E-30
sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 481 993 7.0E-30
sp|B2USN4|IF2_HELPS Translation initiation factor IF-2 OS=Helicobacter pylori (strain Shi470) GN=infB PE=3 SV=1 481 918 7.0E-30
sp|Q7VLI2|IF2_HAEDU Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 481 993 8.0E-30
sp|A5IHU7|IF2_LEGPC Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 471 980 8.0E-30
sp|Q64ZR4|IF2_BACFR Translation initiation factor IF-2 OS=Bacteroides fragilis (strain YCH46) GN=infB PE=3 SV=1 481 928 8.0E-30
sp|Q5LIN1|IF2_BACFN Translation initiation factor IF-2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=infB PE=3 SV=1 481 928 8.0E-30
sp|C5CLW3|IF2_VARPS Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 481 933 9.0E-30
sp|B2UAA3|IF2_RALPJ Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 481 993 9.0E-30
sp|Q5FGX3|IF2_EHRRG Translation initiation factor IF-2 OS=Ehrlichia ruminantium (strain Gardel) GN=infB PE=3 SV=1 481 980 9.0E-30
sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 481 934 9.0E-30
sp|A5GVG4|IF2_SYNR3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain RCC307) GN=infB PE=3 SV=1 481 929 9.0E-30
sp|B8J1Y4|IF2_DESDA Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 481 928 1.0E-29
sp|Q57JH9|IF2_SALCH Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|Q38W81|IF2_LACSS Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 474 929 1.0E-29
sp|A8AQ58|IF2_CITK8 Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 481 980 1.0E-29
sp|Q9ZF31|IF2_SALTY Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 481 993 1.0E-29
sp|C0PZ54|IF2_SALPC Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|A9N732|IF2_SALPB Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B4T6Z8|IF2_SALNS Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B4TJ06|IF2_SALHS Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B5QZV8|IF2_SALEP Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B5FI13|IF2_SALDC Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B5F6T8|IF2_SALA4 Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|P65134|IF2_STAAN Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 481 934 1.0E-29
sp|P65133|IF2_STAAM Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|A7MQE1|IF2_CROS8 Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 481 934 1.0E-29
sp|B4TWD8|IF2_SALSV Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|B5REN6|IF2_SALG2 Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|A9ABD5|IF2_BURM1 Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 481 993 1.0E-29
sp|Q11PK5|IF2_CYTH3 Translation initiation factor IF-2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=infB PE=3 SV=1 481 937 1.0E-29
sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 480 969 1.0E-29
sp|A0LV27|IF2_ACIC1 Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 481 937 2.0E-29
sp|Q8CJQ8|IF2_STRCO Translation initiation factor IF-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=infB PE=3 SV=1 480 937 2.0E-29
sp|A0PQC4|IF2_MYCUA Translation initiation factor IF-2 OS=Mycobacterium ulcerans (strain Agy99) GN=infB PE=3 SV=1 481 937 2.0E-29
sp|Q2JSB7|IF2_SYNJA Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=infB PE=3 SV=1 481 918 2.0E-29
sp|A9MP36|IF2_SALAR Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 481 993 2.0E-29
sp|Q49X54|IF2_STAS1 Translation initiation factor IF-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=infB PE=3 SV=1 481 929 2.0E-29
sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 481 929 2.0E-29
sp|B2HKS2|IF2_MYCMM Translation initiation factor IF-2 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=infB PE=3 SV=1 481 937 2.0E-29
sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 481 980 2.0E-29
sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 477 980 2.0E-29
sp|Q8UJ51|IF2_AGRFC Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 481 980 2.0E-29
sp|Q0BFY3|IF2_BURCM Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 481 993 2.0E-29
sp|P55972|IF2_HELPY Translation initiation factor IF-2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=infB PE=3 SV=1 481 918 2.0E-29
sp|Q8Z3H7|IF2_SALTI Translation initiation factor IF-2 OS=Salmonella typhi GN=infB PE=3 SV=1 481 993 2.0E-29
sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 481 969 3.0E-29
sp|B5BGJ5|IF2_SALPK Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 481 993 3.0E-29
sp|Q5PLB0|IF2_SALPA Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 481 993 3.0E-29
sp|Q5WT36|IF2_LEGPL Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 471 980 3.0E-29
sp|Q5FQM3|IF2_GLUOX Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 481 993 3.0E-29
sp|B7GNA3|IF2_BIFLS Translation initiation factor IF-2 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=infB PE=3 SV=1 481 993 3.0E-29
sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 481 934 3.0E-29
sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 481 934 3.0E-29
sp|B1LFS0|IF2_ECOSM Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 481 993 3.0E-29
sp|Q1WUF4|IF2_LACS1 Translation initiation factor IF-2 OS=Lactobacillus salivarius (strain UCC118) GN=infB PE=3 SV=1 481 929 3.0E-29
sp|Q5GXU9|IF2_XANOR Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 471 993 3.0E-29
sp|Q2P0X1|IF2_XANOM Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 471 993 3.0E-29
sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 481 929 3.0E-29
sp|B2SVK3|IF2_XANOP Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 471 993 4.0E-29
sp|B2GBN7|IF2_LACF3 Translation initiation factor IF-2 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=infB PE=3 SV=1 481 929 4.0E-29
sp|Q3BRP5|IF2_XANC5 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|A9ITX6|IF2_BORPD Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 481 980 4.0E-29
sp|Q32BG5|IF2_SHIDS Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|B8DG02|IF2_LISMH Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=infB PE=3 SV=1 481 929 4.0E-29
sp|Q7MYY7|IF2_PHOLL Translation initiation factor IF-2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|Q8G3Y5|IF2_BIFLO Translation initiation factor IF-2 OS=Bifidobacterium longum (strain NCC 2705) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|Q2NW23|IF2_SODGM Translation initiation factor IF-2 OS=Sodalis glossinidius (strain morsitans) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|Q4L5X1|IF2_STAHJ Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 481 934 4.0E-29
sp|B2U207|IF2_SHIB3 Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 481 993 4.0E-29
sp|B1YP36|IF2_BURA4 Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q3AQK7|IF2_CHLCH Translation initiation factor IF-2 OS=Chlorobium chlorochromatii (strain CaD3) GN=infB PE=3 SV=1 481 928 5.0E-29
sp|Q8PJ55|IF2_XANAC Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B3DQF0|IF2_BIFLD Translation initiation factor IF-2 OS=Bifidobacterium longum (strain DJO10A) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B0RRB4|IF2_XANCB Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q8P7U7|IF2_XANCP Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q83JF9|IF2_SHIFL Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q31W47|IF2_SHIBS Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q1IZ02|IF2_DEIGD Translation initiation factor IF-2 OS=Deinococcus geothermalis (strain DSM 11300) GN=infB PE=3 SV=1 452 918 5.0E-29
sp|Q1R6H0|IF2_ECOUT Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B6I1P3|IF2_ECOSE Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7NDF4|IF2_ECOLU Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|P0A705|IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 481 993 5.0E-29
sp|B1IQV3|IF2_ECOLC Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|P59587|IF2_ECOL6 Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q0TCU1|IF2_ECOL5 Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|A1AG73|IF2_ECOK1 Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 481 993 5.0E-29
sp|A8A4Y4|IF2_ECOHS Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B1XGY0|IF2_ECODH Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|C4ZSQ9|IF2_ECOBW Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7M076|IF2_ECO8A Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7NKN7|IF2_ECO7I Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B5YS58|IF2_ECO5E Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|P0A706|IF2_ECO57 Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7LHN3|IF2_ECO55 Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7MB89|IF2_ECO45 Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|B7UJ63|IF2_ECO27 Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|A7ZS65|IF2_ECO24 Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 481 929 5.0E-29
sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 481 929 5.0E-29
sp|Q0T0B3|IF2_SHIF8 Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q1CC07|IF2_YERPA Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q3YX73|IF2_SHISS Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q6D9A5|IF2_PECAS Translation initiation factor IF-2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=infB PE=3 SV=1 480 993 5.0E-29
sp|B7LR37|IF2_ESCF3 Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 481 993 5.0E-29
sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 481 929 5.0E-29
sp|A7HZ93|IF2_PARL1 Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 481 980 6.0E-29
sp|Q5F797|IF2_NEIG1 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=infB PE=3 SV=1 481 993 6.0E-29
sp|Q1LSK8|IF2_BAUCH Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 481 939 6.0E-29
sp|Q9Z8M1|IF2_CHLPN Translation initiation factor IF-2 OS=Chlamydia pneumoniae GN=infB PE=3 SV=2 476 929 6.0E-29
sp|Q8EQU1|IF2_OCEIH Translation initiation factor IF-2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=infB PE=3 SV=1 481 929 6.0E-29
sp|B4SQS0|IF2_STRM5 Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 481 993 6.0E-29
sp|Q6A7M5|IF2_PROAC Translation initiation factor IF-2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=infB PE=3 SV=1 481 937 6.0E-29
sp|Q4UWA2|IF2_XANC8 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 474 993 7.0E-29
sp|B4RMZ3|IF2_NEIG2 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=infB PE=3 SV=1 481 993 7.0E-29
sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 481 980 7.0E-29
sp|B7N0V3|IF2_ECO81 Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 481 993 7.0E-29
sp|A4TCF8|IF2_MYCGI Translation initiation factor IF-2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=infB PE=3 SV=1 480 928 7.0E-29
sp|Q254H4|IF2_CHLFF Translation initiation factor IF-2 OS=Chlamydophila felis (strain Fe/C-56) GN=infB PE=3 SV=1 476 929 7.0E-29
sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 481 929 8.0E-29
sp|C1L2N1|IF2_LISMC Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 481 929 8.0E-29
sp|A9R5A3|IF2_YERPG Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=infB PE=3 SV=1 481 993 8.0E-29
sp|A4XL70|IF2_CALS8 Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 481 929 9.0E-29
sp|Q3YS01|IF2_EHRCJ Translation initiation factor IF-2 OS=Ehrlichia canis (strain Jake) GN=infB PE=3 SV=1 481 980 9.0E-29
sp|C5BWS3|IF2_BEUC1 Translation initiation factor IF-2 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=infB PE=3 SV=1 473 937 1.0E-28
sp|Q5WFU2|IF2_BACSK Translation initiation factor IF-2 OS=Bacillus clausii (strain KSM-K16) GN=infB PE=3 SV=1 481 929 1.0E-28
sp|B1MD87|IF2_MYCA9 Translation initiation factor IF-2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=infB PE=3 SV=1 481 937 1.0E-28
sp|A4SY78|IF2_POLSQ Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 481 993 1.0E-28
sp|A1T7H8|IF2_MYCVP Translation initiation factor IF-2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|A7GRE3|IF2_BACCN Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 481 929 1.0E-28
sp|C6DKK3|IF2_PECCP Translation initiation factor IF-2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=infB PE=3 SV=1 481 993 1.0E-28
sp|P9WKK1|IF2_MYCTU Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=infB PE=1 SV=1 480 928 1.0E-28
sp|P9WKK0|IF2_MYCTO Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|A5U6J1|IF2_MYCTA Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|C1AFV3|IF2_MYCBT Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|A1KMI2|IF2_MYCBP Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|P65132|IF2_MYCBO Translation initiation factor IF-2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=infB PE=3 SV=1 480 928 1.0E-28
sp|Q2NIQ6|IF2_AYWBP Translation initiation factor IF-2 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=infB PE=3 SV=1 483 935 1.0E-28
sp|A1R516|IF2_ARTAT Translation initiation factor IF-2 OS=Arthrobacter aurescens (strain TC1) GN=infB PE=3 SV=1 481 937 1.0E-28
sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 481 969 1.0E-28
sp|B9JYK6|IF2_AGRVS Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 481 980 2.0E-28
sp|B1JLY0|IF2_YERPY Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|Q66F60|IF2_YERPS Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|A4TRI3|IF2_YERPP Translation initiation factor IF-2 OS=Yersinia pestis (strain Pestoides F) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|Q1CEL3|IF2_YERPN Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|Q8ZBC2|IF2_YERPE Translation initiation factor IF-2 OS=Yersinia pestis GN=infB PE=3 SV=2 481 993 2.0E-28
sp|B2K2Q5|IF2_YERPB Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|A7FMS2|IF2_YERP3 Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|Q3ZXU3|IF2_DEHMC Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain CBDB1) GN=infB PE=3 SV=1 480 929 2.0E-28
sp|A5FQR6|IF2_DEHMB Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=infB PE=3 SV=1 480 929 2.0E-28
sp|C5C9T1|IF2_MICLC Translation initiation factor IF-2 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=infB PE=3 SV=1 481 937 2.0E-28
sp|B2G6V6|IF2_LACRJ Translation initiation factor IF-2 OS=Lactobacillus reuteri (strain JCM 1112) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|A5VJE0|IF2_LACRD Translation initiation factor IF-2 OS=Lactobacillus reuteri (strain DSM 20016) GN=infB PE=3 SV=1 481 993 2.0E-28
sp|Q7U8L9|IF2_SYNPX Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 481 929 2.0E-28
sp|A1BDF1|IF2_CHLPD Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 480 928 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3501
MAPKKRSVNAAQENWEVELGGQTVVSPVTSDDGPAAADLVGNPEETSGGCGGLMAMLRKNKEKRKKKGLQYDDSA
QDKDQGFIPAPDQTCKAPQEALMDEFALPDKKGKGGGKGKQAAEHNELEDDDVKGGRILTKAEKEKMKREREKQR
KKEQAAKKKASGPSKVPEPVKAENTNKESVTETSSPVSPDTVVKKKKIPAHLAAIQKQQEELRQRREEEERIQAE
AKARAVEEEHLAAEEMKRREEQKAVKKQKDKERIEQLKKEGKFLTKAQKEEKARNERKLQQMLAAGVKVGPQKSV
DNEPKKKSGSENKKRRGKNEQKIDEAVLAEAAVRARNLAEKSMREAEESAARAKAEAEAMTAPEKRTAKSDDDWE
ATAEADDNVKESWDAESDDGANNRVATAIANRSAARSLVSKQQSHDGFKVEDGGPDESESLSADDPEDDGVSAAR
QAEAQRKKEAAERREKAHQAALAARSKDNLRSPICCILGHVDTGKTKLLDKVRQTHVQEGEAGGITQQIGATYFP
VDAIRQKTAVINKDNNFEFKVPGLLVIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEQQTLESMRLLRERKT
PFIVALNKIDRLYGWKKVENNGFQESLALQNKAVHNEFKRRLDETKLAFAEQGFNSELFYENKSTAKYVSLVPTS
AHTGEGVPDMLKLIVQLTQERMVGSLMYLSEVQATVLEVKAIEGFGMTIDVILSNGVLKEGDRIVLCGTEGAIKT
NIRALLTPAPLRELRLKSTYVHNKEVKAALGVKISASGLEGAIAGSRLMVVGPDDDEEEIEDEVESDLTNLLSRV
EKSGRGVSVQASTLGSLEALLDFLKDMKIPVANVGIGPVYKRDIMQCGIMLEKAPDYAVMLCFDVKVDREAQSYA
EEQGIKIFTADIIYHLFDAFEEHQKKMLERKKEDLKMLAVFPCILKPIAIFNKTSPIVIGVDVTEGQLKIDTPIA
AVRSNPGTNAKEIISLGRV*
Coding >Hirsu2|3501
ATGGCGCCCAAGAAAAGGAGTGTCAACGCGGCACAAGAAAATTGGGAGGTGGAGCTGGGGGGACAGACCGTCGTT
TCTCCAGTCACCTCAGACGACGGCCCGGCGGCTGCCGATCTAGTCGGGAACCCGGAAGAAACAAGCGGCGGCTGC
GGCGGCCTTATGGCCATGCTCCGAAAGAACAAGGAGAAACGCAAGAAGAAAGGTTTGCAGTACGATGACTCTGCC
CAGGATAAGGACCAAGGATTCATTCCAGCTCCCGATCAGACGTGCAAGGCACCTCAAGAGGCCTTAATGGACGAG
TTTGCCTTGCCAGATAAGAAGGGCAAGGGAGGTGGCAAGGGGAAGCAGGCGGCCGAACACAACGAACTTGAGGAC
GATGATGTCAAGGGTGGACGAATTCTGACGAAGGCCGAGAAAGAGAAAATGAAAAGGGAACGAGAAAAGCAGCGC
AAGAAGGAACAGGCGGCCAAGAAAAAAGCATCCGGGCCGAGCAAGGTTCCTGAGCCTGTCAAGGCCGAAAATACC
AACAAGGAATCCGTCACGGAAACTTCCTCCCCCGTGTCCCCTGATACGGTCGTCAAGAAGAAGAAAATTCCAGCG
CATCTTGCCGCGATTCAGAAGCAGCAGGAAGAGCTGCGCCAGCGACGTGAGGAGGAAGAGCGAATTCAAGCCGAG
GCCAAAGCTCGCGCGGTGGAAGAAGAACATCTAGCTGCTGAGGAAATGAAACGCAGGGAAGAGCAAAAAGCCGTC
AAGAAGCAGAAGGACAAGGAGCGCATCGAGCAACTCAAGAAGGAAGGAAAGTTTCTCACAAAAGCACAAAAGGAG
GAAAAGGCTCGTAACGAAAGGAAGCTGCAGCAGATGCTGGCCGCGGGTGTGAAGGTTGGCCCCCAAAAATCCGTC
GATAACGAGCCGAAGAAGAAGTCTGGGAGCGAAAACAAGAAAAGACGTGGCAAGAACGAACAAAAGATTGACGAA
GCAGTTCTAGCCGAAGCGGCCGTGAGGGCCCGCAATCTAGCCGAGAAGTCCATGAGAGAGGCTGAAGAATCAGCC
GCACGGGCAAAGGCTGAGGCTGAAGCAATGACAGCTCCCGAGAAGCGAACTGCCAAAAGCGACGATGATTGGGAA
GCTACAGCCGAGGCCGATGACAATGTCAAAGAAAGCTGGGATGCCGAATCAGACGATGGGGCCAATAATCGCGTC
GCGACCGCGATTGCAAACCGTTCTGCGGCGAGAAGCCTTGTTTCGAAGCAGCAAAGCCATGACGGATTCAAGGTC
GAAGACGGTGGGCCGGATGAAAGCGAGAGCCTGTCTGCCGATGACCCTGAGGACGACGGTGTTTCTGCGGCACGA
CAGGCCGAGGCCCAGCGCAAGAAGGAAGCCGCGGAAAGGAGGGAAAAGGCCCATCAAGCAGCCCTGGCCGCCCGC
TCCAAGGACAACTTGCGTTCGCCAATCTGTTGCATCCTAGGTCACGTCGACACCGGGAAGACCAAATTACTGGAC
AAGGTTCGCCAGACGCATGTTCAGGAAGGCGAGGCAGGTGGTATTACACAGCAGATTGGCGCCACATATTTTCCC
GTTGATGCGATCCGACAGAAAACTGCTGTTATCAACAAGGATAATAATTTCGAATTCAAAGTCCCTGGTCTTCTG
GTCATTGATACTCCTGGTCACGAGTCTTTTTCAAATCTCAGGTCCAGAGGTTCGTCTCTTTGTAACATTGCCATC
CTCGTCGTCGACATCATGCACGGTCTAGAGCAGCAGACCCTAGAATCGATGCGTCTTCTGCGGGAGCGAAAGACG
CCATTCATTGTCGCTCTCAACAAGATAGATAGGCTCTACGGCTGGAAGAAAGTGGAAAATAATGGATTCCAAGAG
AGCCTTGCGCTCCAGAACAAAGCCGTCCACAATGAGTTCAAGAGGCGTCTGGACGAGACAAAGCTCGCGTTTGCT
GAACAAGGCTTTAATTCAGAACTCTTCTACGAGAATAAGTCGACGGCCAAATATGTCTCTCTGGTGCCCACCTCA
GCTCACACCGGTGAGGGTGTGCCTGACATGCTCAAGCTGATTGTTCAGCTCACGCAGGAACGCATGGTTGGCTCT
CTCATGTACTTGTCGGAGGTTCAGGCCACCGTCCTCGAGGTGAAGGCGATCGAGGGTTTTGGCATGACCATCGAC
GTCATCCTTTCCAACGGTGTACTGAAGGAGGGCGACAGGATAGTCTTGTGTGGTACAGAGGGCGCAATCAAGACC
AACATCAGAGCTCTACTGACACCAGCACCGCTTCGCGAACTTCGTTTGAAGTCAACCTATGTACACAATAAGGAG
GTCAAGGCGGCTTTGGGAGTCAAGATAAGTGCTTCCGGGCTTGAAGGTGCCATCGCCGGGTCTAGGCTCATGGTT
GTTGGGCCGGACGATGACGAGGAGGAAATAGAGGATGAAGTGGAATCCGATCTCACCAACCTGCTTAGCAGAGTC
GAAAAGTCTGGCCGCGGAGTCAGCGTCCAGGCATCCACCTTGGGATCCCTTGAGGCTTTATTAGACTTCTTGAAA
GACATGAAAATCCCGGTTGCTAACGTTGGAATCGGCCCAGTCTACAAGCGAGACATCATGCAGTGCGGTATAATG
CTGGAAAAGGCGCCCGACTATGCCGTCATGCTATGCTTTGATGTCAAGGTAGACAGGGAAGCTCAGTCGTATGCC
GAGGAGCAAGGTATCAAGATCTTCACGGCGGACATAATCTATCACCTCTTTGATGCGTTTGAAGAACACCAAAAA
AAAATGTTGGAGAGGAAGAAGGAAGACTTGAAGATGCTCGCCGTCTTCCCCTGCATCCTGAAACCTATCGCCATC
TTCAACAAGACTAGCCCGATTGTTATCGGTGTGGACGTTACAGAGGGGCAGCTCAAAATCGATACACCTATCGCA
GCTGTCAGATCTAATCCGGGAACCAACGCGAAGGAGATAATCAGTCTTGGAAGGGTGTAA
Transcript >Hirsu2|3501
ATGGCGCCCAAGAAAAGGAGTGTCAACGCGGCACAAGAAAATTGGGAGGTGGAGCTGGGGGGACAGACCGTCGTT
TCTCCAGTCACCTCAGACGACGGCCCGGCGGCTGCCGATCTAGTCGGGAACCCGGAAGAAACAAGCGGCGGCTGC
GGCGGCCTTATGGCCATGCTCCGAAAGAACAAGGAGAAACGCAAGAAGAAAGGTTTGCAGTACGATGACTCTGCC
CAGGATAAGGACCAAGGATTCATTCCAGCTCCCGATCAGACGTGCAAGGCACCTCAAGAGGCCTTAATGGACGAG
TTTGCCTTGCCAGATAAGAAGGGCAAGGGAGGTGGCAAGGGGAAGCAGGCGGCCGAACACAACGAACTTGAGGAC
GATGATGTCAAGGGTGGACGAATTCTGACGAAGGCCGAGAAAGAGAAAATGAAAAGGGAACGAGAAAAGCAGCGC
AAGAAGGAACAGGCGGCCAAGAAAAAAGCATCCGGGCCGAGCAAGGTTCCTGAGCCTGTCAAGGCCGAAAATACC
AACAAGGAATCCGTCACGGAAACTTCCTCCCCCGTGTCCCCTGATACGGTCGTCAAGAAGAAGAAAATTCCAGCG
CATCTTGCCGCGATTCAGAAGCAGCAGGAAGAGCTGCGCCAGCGACGTGAGGAGGAAGAGCGAATTCAAGCCGAG
GCCAAAGCTCGCGCGGTGGAAGAAGAACATCTAGCTGCTGAGGAAATGAAACGCAGGGAAGAGCAAAAAGCCGTC
AAGAAGCAGAAGGACAAGGAGCGCATCGAGCAACTCAAGAAGGAAGGAAAGTTTCTCACAAAAGCACAAAAGGAG
GAAAAGGCTCGTAACGAAAGGAAGCTGCAGCAGATGCTGGCCGCGGGTGTGAAGGTTGGCCCCCAAAAATCCGTC
GATAACGAGCCGAAGAAGAAGTCTGGGAGCGAAAACAAGAAAAGACGTGGCAAGAACGAACAAAAGATTGACGAA
GCAGTTCTAGCCGAAGCGGCCGTGAGGGCCCGCAATCTAGCCGAGAAGTCCATGAGAGAGGCTGAAGAATCAGCC
GCACGGGCAAAGGCTGAGGCTGAAGCAATGACAGCTCCCGAGAAGCGAACTGCCAAAAGCGACGATGATTGGGAA
GCTACAGCCGAGGCCGATGACAATGTCAAAGAAAGCTGGGATGCCGAATCAGACGATGGGGCCAATAATCGCGTC
GCGACCGCGATTGCAAACCGTTCTGCGGCGAGAAGCCTTGTTTCGAAGCAGCAAAGCCATGACGGATTCAAGGTC
GAAGACGGTGGGCCGGATGAAAGCGAGAGCCTGTCTGCCGATGACCCTGAGGACGACGGTGTTTCTGCGGCACGA
CAGGCCGAGGCCCAGCGCAAGAAGGAAGCCGCGGAAAGGAGGGAAAAGGCCCATCAAGCAGCCCTGGCCGCCCGC
TCCAAGGACAACTTGCGTTCGCCAATCTGTTGCATCCTAGGTCACGTCGACACCGGGAAGACCAAATTACTGGAC
AAGGTTCGCCAGACGCATGTTCAGGAAGGCGAGGCAGGTGGTATTACACAGCAGATTGGCGCCACATATTTTCCC
GTTGATGCGATCCGACAGAAAACTGCTGTTATCAACAAGGATAATAATTTCGAATTCAAAGTCCCTGGTCTTCTG
GTCATTGATACTCCTGGTCACGAGTCTTTTTCAAATCTCAGGTCCAGAGGTTCGTCTCTTTGTAACATTGCCATC
CTCGTCGTCGACATCATGCACGGTCTAGAGCAGCAGACCCTAGAATCGATGCGTCTTCTGCGGGAGCGAAAGACG
CCATTCATTGTCGCTCTCAACAAGATAGATAGGCTCTACGGCTGGAAGAAAGTGGAAAATAATGGATTCCAAGAG
AGCCTTGCGCTCCAGAACAAAGCCGTCCACAATGAGTTCAAGAGGCGTCTGGACGAGACAAAGCTCGCGTTTGCT
GAACAAGGCTTTAATTCAGAACTCTTCTACGAGAATAAGTCGACGGCCAAATATGTCTCTCTGGTGCCCACCTCA
GCTCACACCGGTGAGGGTGTGCCTGACATGCTCAAGCTGATTGTTCAGCTCACGCAGGAACGCATGGTTGGCTCT
CTCATGTACTTGTCGGAGGTTCAGGCCACCGTCCTCGAGGTGAAGGCGATCGAGGGTTTTGGCATGACCATCGAC
GTCATCCTTTCCAACGGTGTACTGAAGGAGGGCGACAGGATAGTCTTGTGTGGTACAGAGGGCGCAATCAAGACC
AACATCAGAGCTCTACTGACACCAGCACCGCTTCGCGAACTTCGTTTGAAGTCAACCTATGTACACAATAAGGAG
GTCAAGGCGGCTTTGGGAGTCAAGATAAGTGCTTCCGGGCTTGAAGGTGCCATCGCCGGGTCTAGGCTCATGGTT
GTTGGGCCGGACGATGACGAGGAGGAAATAGAGGATGAAGTGGAATCCGATCTCACCAACCTGCTTAGCAGAGTC
GAAAAGTCTGGCCGCGGAGTCAGCGTCCAGGCATCCACCTTGGGATCCCTTGAGGCTTTATTAGACTTCTTGAAA
GACATGAAAATCCCGGTTGCTAACGTTGGAATCGGCCCAGTCTACAAGCGAGACATCATGCAGTGCGGTATAATG
CTGGAAAAGGCGCCCGACTATGCCGTCATGCTATGCTTTGATGTCAAGGTAGACAGGGAAGCTCAGTCGTATGCC
GAGGAGCAAGGTATCAAGATCTTCACGGCGGACATAATCTATCACCTCTTTGATGCGTTTGAAGAACACCAAAAA
AAAATGTTGGAGAGGAAGAAGGAAGACTTGAAGATGCTCGCCGTCTTCCCCTGCATCCTGAAACCTATCGCCATC
TTCAACAAGACTAGCCCGATTGTTATCGGTGTGGACGTTACAGAGGGGCAGCTCAAAATCGATACACCTATCGCA
GCTGTCAGATCTAATCCGGGAACCAACGCGAAGGAGATAATCAGTCTTGGAAGGGTGTAA
Gene >Hirsu2|3501
ATGGCGCCCAAGAAAAGGAGTGTCAACGCGGCACAAGAAAATTGGGAGGTGGAGCTGGGGGGACAGACCGTCGTT
TCTCCAGTCACCTCAGACGACGGCCCGGCGGCTGCCGATCTAGTCGGGAACCCGGAAGAAACAAGCGGCGGCTGC
GGCGGCCTTATGGCCATGCTCCGAAAGAACAAGGAGAAACGCAAGAAGAAAGGTTTGCAGTACGATGACTCTGCC
CAGGATAAGGACCAAGGATTCATTCCAGCTCCCGATCAGACGTGCAAGGCACCTCAAGAGGCCTTAATGGACGAG
TTTGCCTTGCCAGATAAGAAGGGCAAGGGAGGTGGCAAGGGGAAGCAGGCGGCCGAACACAACGAACTTGAGGAC
GATGATGTCAAGGGTGGACGAATTCTGACGAAGGCCGAGAAAGAGAAAATGAAAAGGGAACGAGAAAAGCAGCGC
AAGAAGGAACAGGTATCAGGAACCCCCCCCCCCCCCCCTTCCCCCTCTTCTCCCGGCAACCTCTCGCTATCCATT
GCCCATCCTGCCGGCTGCGTCCCAAAGCCGCCGTAGGTCATATTCTAATCGCATCACTCTGGCATGATTTAGGCG
GCCAAGAAAAAAGCATCCGGGCCGAGCAAGGTTCCTGAGCCTGTCAAGGCCGAAAATACCAACAAGGAATCCGTC
ACGGAAACTTCCTCCCCCGTGTCCCCTGATACGGTCGTCAAGAAGAAGAAAATTCCAGCGCATCTTGCCGCGATT
CAGAAGCAGCAGGAAGAGCTGCGCCAGCGACGTGAGGAGGAAGAGCGAATTCAAGCCGAGGCCAAAGCTCGCGCG
GTGGAAGAAGAACATCTAGCTGCTGAGGAAATGAAACGCAGGGAAGAGCAAAAAGCCGTCAAGAAGCAGAAGGAC
AAGGAGCGCATCGAGCAACTCAAGAAGGAAGGAAAGTTTCTCACAAAAGCACAAAAGGAGGAAAAGGCTCGTAAC
GAAAGGAAGCTGCAGCAGATGCTGGCCGCGGGTGTGAAGGTTGGCCCCCAAAAATCCGTCGATAACGAGCCGAAG
AAGAAGTCTGGGAGCGAAAACAAGAAAAGACGTGGCAAGAACGAACAAAAGGTCAGAGTCATTCAGTGCCGCCTA
CCATCTGAATATCGGTGCTCATTGCTTGCAGATTGACGAAGCAGTTCTAGCCGAAGCGGCCGTGAGGGCCCGCAA
TCTAGCCGAGAAGTCCATGAGAGAGGCTGAAGAATCAGCCGCACGGGCAAAGGCTGAGGCTGAAGCAATGACAGC
TCCCGAGAAGCGAACTGCCAAAAGCGACGATGATTGGGAAGCTACAGCCGAGGCCGATGACAATGTCAAAGAAAG
CTGGGATGCCGAATCAGACGATGGGGCCAATAATCGCGTCGCGACCGCGATTGCAAACCGTTCTGCGGCGAGAAG
CCTTGTTTCGAAGCAGCAAAGCCATGACGGATTCAAGGTCGAAGACGGTGGGCCGGATGAAAGCGAGAGCCTGTC
TGCCGATGACCCTGAGGACGACGGTGTTTCTGCGGCACGACAGGCCGAGGCCCAGCGCAAGAAGGAAGCCGCGGA
AAGGAGGGAAAAGGCCCATCAAGCAGCCCTGGCCGCCCGCTCCAAGGACAACTTGCGTTCGCCAATCTGTTGCAT
CCTAGGTCACGTCGACACCGGGAAGACCAAATTACTGGACAAGGTTCGCCAGACGCATGTTCAGGAAGGCGAGGC
AGGTGGTATTACACAGCAGATTGGCGCCACATATTTTCCCGTTGATGCGATCCGACAGAAAACTGCTGTTATCAA
CAAGGATAATAATTTCGAATTCAAAGTCCCTGGTCTTCTGGTCATTGATACTCCTGGTCACGAGTCTTTTTCAAA
TCTCAGGTCCAGAGGTTCGTCTCTTTGTAACATTGCCATCCTCGTCGTCGACATCATGCACGGTCTAGAGCAGCA
GACCCTAGAATCGATGCGTCTTCTGCGGGAGCGAAAGACGCCATTCATTGTCGCTCTCAACAAGATAGATAGGCT
CTACGGCTGGAAGAAAGTGGAAAATAATGGATTCCAAGAGAGCCTTGCGCTCCAGAACAAAGCCGTCCACAATGA
GTTCAAGAGGCGTCTGGACGAGACAAAGCTCGCGTTTGCTGAACAAGGCTTTAATTCAGAACTCTTCTACGAGAA
TAAGTCGACGGCCAAATATGTCTCTCTGGTGCCCACCTCAGCTCACACCGGTGAGGGTGTGCCTGACATGCTCAA
GCTGATTGTTCAGCTCACGCAGGAACGCATGGTTGGCTCTCTCATGTACTTGTCGGAGGTTCAGGCCACCGTCCT
CGAGGTGAAGGCGATCGAGGGTTTTGGCATGACCATCGACGTCATCCTTTCCAACGGTGTACTGAAGGAGGGCGA
CAGGATAGTCTTGTGTGGTACAGAGGGCGCAATCAAGACCAACATCAGAGCTCTACTGACACCAGCACCGCTTCG
CGAACTTCGTTTGAAGTCAACCTATGTACACAATAAGGAGGTCAAGGCGGCTTTGGGAGTCAAGATAAGTGCTTC
CGGGCTTGAAGGTGCCATCGCCGGGTCTAGGCTCATGGTTGTTGGGCCGGACGATGACGAGGAGGAAATAGAGGA
TGAAGTGGAATCCGATCTCACCAACCTGCTTAGCAGAGTCGAAAAGTCTGGCCGCGGAGTCAGCGTCCAGGCATC
CACCTTGGGATCCCTTGAGGCTTTATTAGACTTCTTGAAAGACATGAAAATCCCGGTTGCTAACGTTGGAATCGG
CCCAGTCTACAAGCGAGACATCATGCAGTGCGGTATAATGCTGGAAAAGGCGCCCGACTATGCCGTCATGCTATG
CTTTGATGTCAAGGTAGACAGGGAAGCTCAGTCGTATGCCGAGGAGCAAGGTATCAAGATCTTCACGGCGGACAT
AATCTATCACCTCTTTGATGCGTTTGAAGAACACCAAAAAAAAATGTTGGAGAGGAAGAAGGAAGACTTGAAGAT
GCTCGCCGTCTTCCCCTGCATCCTGAAACCTATCGCCATCTTCAACAAGACTAGCCCGATTGTTATCGGTGTGGA
CGTTACAGAGGGGCAGCTCAAAATCGATACACCTATCGCAGCTGTCAGATCTAATCCGGGAACCAACGCGAAGGA
GATAATCAGTCTTGGAAGGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail