Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|350
Gene name
LocationContig_1068:2358..5111
Strand+
Gene length (bp)2753
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04468 PSP1 PSP1 C-terminal conserved region 1.1E-28 621 704

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V4|YOM2_SCHPO Uncharacterized protein PB7E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB7E8.02 PE=3 SV=1 500 712 7.0E-34
sp|Q06251|YL177_YEAST Uncharacterized protein YLR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR177W PE=1 SV=1 496 704 4.0E-18
sp|P50896|PSP1_YEAST Protein PSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSP1 PE=1 SV=2 500 704 5.0E-18
sp|P37541|YAAT_BACSU Stage 0 sporulation protein YaaT OS=Bacillus subtilis (strain 168) GN=yaaT PE=3 SV=1 623 724 5.0E-11

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7648 0.4344 0.1015 0.0597 0.1877 0.0044 0.1067 0.099 0.0926 0.022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2448
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7824
Ophiocordyceps australis map64 (Brazil) OphauB2|6479
Ophiocordyceps camponoti-floridani Ophcf2|06590
Ophiocordyceps camponoti-rufipedis Ophun1|6934
Ophiocordyceps kimflemingae Ophio5|4211
Ophiocordyceps subramaniannii Hirsu2|350 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|350
MSAVSLKTGRSSKLGQGPAGSQSSQSLLLEKVNARTSTPDSEALASSEDEGEHRQDAPQAPVVQSQKPVRRSSWL
NDTSQTLSRPRKGSFASSSMSPTGSHPSTPSAEAGNGPWGSHSASSVMGRATASSTFHWGTGIWNDRKDAPSRLS
EVLPSPTSTVPPGAAGNSFFGPDVGLTQASREPGPNPQIPFAIPLHPTPKTYRSQSYSVGQLDPENAPPPTVGSS
AAMGRARHPGLQHRPSRPSMLSEMANDPPVLGKVKEVEGDDEGATEPLQGSFHQMSESRTIEMLTRENAMLRQQQ
QYNNRIRPRASTGAGYLANGYPLREAVPEESDYAVDELDEANEAGDAFGRRASGRRMSEYGGGPARTLGMDNRKL
ENMNLKKALWSSSPGFFAGDISQSRRHSFANMPTRQGSISSVADPASALDANGGDQGFAAFADNPAFSSSHGNPA
LFNGVSAGLQAAFNPSYASPFGYQDQYSNRAPSPHRGVYGMAQPRHNQLLHVVLFKCARADVFYIQEGTGLTVKP
GDLVIVEADRGTDLGTVAKDNVDWQSAKELKEHYAEEHYKWLMMYSQGAAAAQEGTGPGLLTAASGFHGSAVGGM
GPPSQHHIQEPSAGDLRPKLIKRLAQSHEVHSLRDKEGQEAKAKRVCMQKVKEHGLNMEILDAEFQMDWKKLTFY
YFADSYINFNSLVTDLFKIYKTRIWMSAINPASFASPTLGIQAPSGVGPGAVGVGRASGGAERRQNQQAQEQQPQ
AFAQAPQVARGFRAAFNQPFGGDRQVPTASGYPASNYAYGAGGAFGNARGGASYVPSLSPGLDAYSHAGYQQAGD
FQSLRQRLPPSQGVSSPAAHTQNLSPLGSQNDWTSAFQGLSLNTH*
Coding >Hirsu2|350
ATGAGCGCCGTCTCTCTCAAGACCGGACGTTCCTCCAAACTGGGCCAAGGACCCGCCGGCTCGCAAAGCAGCCAG
AGCCTGCTTTTGGAGAAGGTCAACGCGCGAACCTCGACCCCAGACTCCGAGGCCCTTGCCAGCTCCGAAGACGAG
GGCGAGCACCGCCAGGACGCACCTCAGGCCCCAGTCGTGCAGTCGCAAAAGCCGGTTCGTCGATCTTCGTGGCTG
AACGACACGTCGCAGACCCTCTCCCGCCCTCGAAAGGGTTCCTTCGCCAGCAGCTCCATGTCTCCCACCGGCTCC
CACCCCAGCACACCCTCAGCCGAGGCCGGCAACGGGCCCTGGGGCTCCCATTCCGCCTCGTCCGTCATGGGCCGC
GCCACGGCCTCCTCCACCTTCCACTGGGGAACTGGCATCTGGAACGATCGCAAGGATGCGCCGTCGAGACTCAGT
GAAGTCTTGCCTTCGCCAACGTCGACGGTTCCGCCGGGTGCCGCCGGTAACTCCTTCTTCGGTCCCGACGTTGGT
CTGACGCAAGCCTCGCGCGAGCCCGGCCCGAACCCGCAGATTCCCTTTGCCATTCCTCTCCATCCCACCCCGAAG
ACGTACCGCTCCCAGTCGTACTCGGTGGGGCAGCTGGACCCCGAAAATGCCCCCCCGCCGACCGTCGGCTCGTCG
GCGGCCATGGGGCGTGCGCGGCACCCCGGCCTGCAGCACCGGCCGTCCCGGCCGAGCATGCTGAGCGAGATGGCA
AACGACCCGCCCGTTCTCGGCAAAGTCAAGGAGGTCGAGGGTGACGACGAGGGCGCGACGGAACCGCTTCAGGGC
TCGTTCCATCAAATGTCGGAATCCAGGACGATCGAGATGCTTACGCGCGAGAACGCCATGCTTCGCCAGCAACAG
CAATACAACAACCGCATCCGACCGCGCGCCTCTACGGGGGCGGGCTATCTGGCCAACGGATATCCTTTGCGAGAG
GCTGTTCCCGAAGAGTCCGACTACGCCGTTGACGAGCTGGACGAAGCCAACGAGGCCGGCGATGCTTTTGGACGA
CGTGCGAGCGGCCGACGGATGAGCGAATACGGTGGCGGTCCCGCCCGCACCCTCGGAATGGACAATCGGAAGCTG
GAAAACATGAATCTGAAGAAAGCTCTTTGGTCAAGCTCACCCGGATTCTTCGCGGGAGATATTTCGCAGAGCAGA
CGCCACTCATTTGCCAACATGCCTACACGCCAGGGCTCCATCAGCTCCGTCGCCGATCCCGCCTCGGCTCTGGAC
GCGAATGGGGGCGATCAAGGGTTCGCGGCCTTTGCCGACAACCCGGCTTTCTCGAGCTCTCATGGCAACCCAGCC
TTGTTCAACGGCGTCTCTGCCGGTCTCCAAGCAGCCTTCAACCCATCCTACGCGTCTCCCTTCGGATATCAAGAT
CAGTATTCAAACCGGGCGCCGTCTCCCCACCGAGGCGTCTACGGGATGGCGCAGCCGAGGCACAACCAGCTTCTC
CACGTCGTCCTGTTCAAATGCGCTCGGGCCGACGTCTTCTACATCCAGGAGGGCACTGGGCTGACGGTCAAGCCC
GGCGACCTGGTCATCGTCGAAGCCGATCGCGGCACTGATCTCGGCACTGTCGCCAAGGACAACGTCGACTGGCAG
TCGGCCAAAGAACTCAAGGAACATTATGCCGAGGAACACTACAAGTGGCTCATGATGTACTCACAAGGCGCCGCG
GCGGCGCAGGAGGGAACTGGCCCCGGCCTCCTGACCGCAGCCAGCGGCTTTCACGGGAGCGCCGTGGGCGGCATG
GGCCCCCCAAGCCAGCATCATATACAGGAGCCGAGTGCCGGGGACCTGCGGCCGAAACTGATCAAGCGCCTCGCC
CAGAGCCACGAGGTTCATTCCTTGCGGGACAAGGAAGGCCAGGAGGCCAAGGCGAAGAGAGTGTGCATGCAGAAA
GTCAAGGAACATGGGTTGAACATGGAGATCCTCGACGCCGAGTTTCAAATGGACTGGAAAAAGCTCACCTTCTAT
TATTTCGCCGATTCGTACATCAACTTCAATTCGCTTGTGACGGACCTTTTCAAGATATACAAGACTAGAATCTGG
ATGTCAGCGATAAACCCTGCGTCTTTTGCCAGCCCGACCCTGGGAATACAGGCGCCAAGCGGTGTCGGGCCTGGC
GCCGTCGGCGTCGGACGTGCTTCGGGCGGTGCCGAGCGTCGGCAGAACCAGCAGGCCCAAGAGCAGCAGCCGCAG
GCGTTCGCCCAGGCGCCACAGGTCGCTCGCGGATTCCGCGCCGCCTTCAACCAGCCGTTCGGGGGCGACAGGCAA
GTCCCGACGGCATCGGGATATCCAGCATCGAACTACGCTTATGGGGCGGGCGGGGCGTTTGGGAATGCCCGAGGC
GGTGCGTCGTACGTGCCGAGCCTCTCGCCAGGCCTGGACGCATATTCCCACGCCGGCTATCAGCAGGCCGGGGAC
TTCCAGTCCTTGCGCCAACGCCTGCCGCCTTCGCAGGGCGTCTCCAGTCCCGCAGCCCACACCCAGAACCTCTCG
CCCCTCGGTTCGCAGAACGATTGGACTAGCGCCTTCCAGGGGCTGTCTCTCAACACGCACTGA
Transcript >Hirsu2|350
ATGAGCGCCGTCTCTCTCAAGACCGGACGTTCCTCCAAACTGGGCCAAGGACCCGCCGGCTCGCAAAGCAGCCAG
AGCCTGCTTTTGGAGAAGGTCAACGCGCGAACCTCGACCCCAGACTCCGAGGCCCTTGCCAGCTCCGAAGACGAG
GGCGAGCACCGCCAGGACGCACCTCAGGCCCCAGTCGTGCAGTCGCAAAAGCCGGTTCGTCGATCTTCGTGGCTG
AACGACACGTCGCAGACCCTCTCCCGCCCTCGAAAGGGTTCCTTCGCCAGCAGCTCCATGTCTCCCACCGGCTCC
CACCCCAGCACACCCTCAGCCGAGGCCGGCAACGGGCCCTGGGGCTCCCATTCCGCCTCGTCCGTCATGGGCCGC
GCCACGGCCTCCTCCACCTTCCACTGGGGAACTGGCATCTGGAACGATCGCAAGGATGCGCCGTCGAGACTCAGT
GAAGTCTTGCCTTCGCCAACGTCGACGGTTCCGCCGGGTGCCGCCGGTAACTCCTTCTTCGGTCCCGACGTTGGT
CTGACGCAAGCCTCGCGCGAGCCCGGCCCGAACCCGCAGATTCCCTTTGCCATTCCTCTCCATCCCACCCCGAAG
ACGTACCGCTCCCAGTCGTACTCGGTGGGGCAGCTGGACCCCGAAAATGCCCCCCCGCCGACCGTCGGCTCGTCG
GCGGCCATGGGGCGTGCGCGGCACCCCGGCCTGCAGCACCGGCCGTCCCGGCCGAGCATGCTGAGCGAGATGGCA
AACGACCCGCCCGTTCTCGGCAAAGTCAAGGAGGTCGAGGGTGACGACGAGGGCGCGACGGAACCGCTTCAGGGC
TCGTTCCATCAAATGTCGGAATCCAGGACGATCGAGATGCTTACGCGCGAGAACGCCATGCTTCGCCAGCAACAG
CAATACAACAACCGCATCCGACCGCGCGCCTCTACGGGGGCGGGCTATCTGGCCAACGGATATCCTTTGCGAGAG
GCTGTTCCCGAAGAGTCCGACTACGCCGTTGACGAGCTGGACGAAGCCAACGAGGCCGGCGATGCTTTTGGACGA
CGTGCGAGCGGCCGACGGATGAGCGAATACGGTGGCGGTCCCGCCCGCACCCTCGGAATGGACAATCGGAAGCTG
GAAAACATGAATCTGAAGAAAGCTCTTTGGTCAAGCTCACCCGGATTCTTCGCGGGAGATATTTCGCAGAGCAGA
CGCCACTCATTTGCCAACATGCCTACACGCCAGGGCTCCATCAGCTCCGTCGCCGATCCCGCCTCGGCTCTGGAC
GCGAATGGGGGCGATCAAGGGTTCGCGGCCTTTGCCGACAACCCGGCTTTCTCGAGCTCTCATGGCAACCCAGCC
TTGTTCAACGGCGTCTCTGCCGGTCTCCAAGCAGCCTTCAACCCATCCTACGCGTCTCCCTTCGGATATCAAGAT
CAGTATTCAAACCGGGCGCCGTCTCCCCACCGAGGCGTCTACGGGATGGCGCAGCCGAGGCACAACCAGCTTCTC
CACGTCGTCCTGTTCAAATGCGCTCGGGCCGACGTCTTCTACATCCAGGAGGGCACTGGGCTGACGGTCAAGCCC
GGCGACCTGGTCATCGTCGAAGCCGATCGCGGCACTGATCTCGGCACTGTCGCCAAGGACAACGTCGACTGGCAG
TCGGCCAAAGAACTCAAGGAACATTATGCCGAGGAACACTACAAGTGGCTCATGATGTACTCACAAGGCGCCGCG
GCGGCGCAGGAGGGAACTGGCCCCGGCCTCCTGACCGCAGCCAGCGGCTTTCACGGGAGCGCCGTGGGCGGCATG
GGCCCCCCAAGCCAGCATCATATACAGGAGCCGAGTGCCGGGGACCTGCGGCCGAAACTGATCAAGCGCCTCGCC
CAGAGCCACGAGGTTCATTCCTTGCGGGACAAGGAAGGCCAGGAGGCCAAGGCGAAGAGAGTGTGCATGCAGAAA
GTCAAGGAACATGGGTTGAACATGGAGATCCTCGACGCCGAGTTTCAAATGGACTGGAAAAAGCTCACCTTCTAT
TATTTCGCCGATTCGTACATCAACTTCAATTCGCTTGTGACGGACCTTTTCAAGATATACAAGACTAGAATCTGG
ATGTCAGCGATAAACCCTGCGTCTTTTGCCAGCCCGACCCTGGGAATACAGGCGCCAAGCGGTGTCGGGCCTGGC
GCCGTCGGCGTCGGACGTGCTTCGGGCGGTGCCGAGCGTCGGCAGAACCAGCAGGCCCAAGAGCAGCAGCCGCAG
GCGTTCGCCCAGGCGCCACAGGTCGCTCGCGGATTCCGCGCCGCCTTCAACCAGCCGTTCGGGGGCGACAGGCAA
GTCCCGACGGCATCGGGATATCCAGCATCGAACTACGCTTATGGGGCGGGCGGGGCGTTTGGGAATGCCCGAGGC
GGTGCGTCGTACGTGCCGAGCCTCTCGCCAGGCCTGGACGCATATTCCCACGCCGGCTATCAGCAGGCCGGGGAC
TTCCAGTCCTTGCGCCAACGCCTGCCGCCTTCGCAGGGCGTCTCCAGTCCCGCAGCCCACACCCAGAACCTCTCG
CCCCTCGGTTCGCAGAACGATTGGACTAGCGCCTTCCAGGGGCTGTCTCTCAACACGCACTGA
Gene >Hirsu2|350
ATGAGCGCCGTCTCTCTCAAGACCGGACGTTCCTCCAAACTGGGCCAAGGACCCGCCGGCTCGCAAAGCAGCCAG
AGCCTGCTTTTGGAGAAGGTCAACGCGCGAACCTCGACCCCAGACTCCGAGGCCCTTGCCAGCTCCGAAGACGAG
GGCGAGCACCGCCAGGACGCACCTCAGGCCCCAGTCGTGCAGTCGCAAAAGCCGGTTCGTCGATCTTCGTGGCTG
AACGACACGTCGCAGACCCTCTCCCGCCCTCGAAAGGGTTCCTTCGCCAGCAGCTCCATGTCTCCCACCGGCTCC
CACCCCAGCACACCCTCAGCCGAGGCCGGCAACGGGCCCTGGGGCTCCCATTCCGCCTCGTCCGTCATGGGCCGC
GCCACGGCCTCCTCCACCTTCCACTGGGGAACTGGCATCTGGAACGATCGCAAGGATGCGCCGTCGAGACTCAGT
GAAGTCTTGCCTTCGCCAACGTCGACGGTTCCGCCGGGTGCCGCCGGTAACTCCTTCTTCGGTCCCGACGTTGGT
CTGACGCAAGCCTCGCGCGAGCCCGGCCCGAACCCGCAGATTCCCTTTGCCATTCCTCTCCATCCCACCCCGAAG
ACGTACCGCTCCCAGTCGTACTCGGTGGGGCAGCTGGACCCCGAAAATGCCCCCCCGCCGACCGTCGGCTCGTCG
GCGGCCATGGGGCGTGCGCGGCACCCCGGCCTGCAGCACCGGCCGTCCCGGCCGAGCATGCTGAGCGAGATGGCA
AACGACCCGCCCGTTCTCGGCAAAGTCAAGGAGGTCGAGGGTGACGACGAGGGCGCGACGGAACCGCTTCAGGGC
TCGTTCCATCAAATGTCGGAATCCAGGACGATCGAGATGCTTACGCGCGAGAACGCCATGCTTCGCCAGCAACAG
CAATACAACAACCGCATCCGACCGCGCGCCTCTACGGGGGCGGGCTATCTGGCCAACGGATATCCTTTGCGAGAG
GCTGTTCCCGAAGAGTCCGACTACGCCGTTGACGAGCTGGACGAAGCCAACGAGGCCGGCGATGCTTTTGGACGA
CGTGCGAGCGGCCGACGGATGAGCGAATACGGTGGCGGTCCCGCCCGCACCCTCGGAATGGACAATCGGAAGCTG
GAAAACATGAATCTGAAGAAAGCTCTTTGGTCAAGCTCACCCGGATTCTTCGCGGGAGATATTTCGCAGAGCAGA
CGCCACTCATTTGCCAACATGCCTACACGCCAGGGCTCCATCAGCTCCGTCGCCGATCCCGCCTCGGCTCTGGAC
GCGAATGGGGGCGATCAAGGGTTCGCGGCCTTTGCCGACAACCCGGCTTTCTCGAGCTCTCATGGCAACCGTGAG
TTCACCCGATTCCCCCCCGCGCACACCCTGCCTGACCTTGTTTCCCGCCCGACAGCAGCCTTGTTCAACGGCGTC
TCTGCCGGTCTCCAAGCAGCCTTCAACCCATCCTACGCGTCTCCCTTCGGATATCAAGATCAGTATTCAAACCGG
GCGCCGTCTCCCCACCGAGGCGTCTACGGGATGGCGCAGCCGAGGCACAACCAGCTTCTCCACGTCGTCCTGTTC
AAATGCGCTCGGGCCGACGTCTTCTACATCCAGGAGGGCACTGGGCTGACGGTCAAGCCCGGCGACCTGGTCATC
GTCGAAGCCGATCGCGGCACTGATCTCGGCACTGTCGCCAAGGACAACGTCGACTGGCAGTCGGCCAAAGAACTC
AAGGAACATTATGCCGAGGAACACTACAAGTGGCTCATGATGTACTCACAAGGCGCCGCGGCGGCGCAGGAGGGA
ACTGGCCCCGGCCTCCTGACCGCAGCCAGCGGCTTTCACGGGAGCGCCGTGGGCGGCATGGGCCCCCCAAGCCAG
CATCATATACAGGAGCCGAGTGCCGGGGACCTGCGGCCGAAACTGATCAAGCGCCTCGCCCAGAGCCACGAGGTT
CATTCCTTGCGGGACAAGGAAGGCCAGGAGGCCAAGGCGAAGAGAGTGTGCATGCAGAAAGTCAAGGAACATGGG
TTGAACATGGAGATCCTCGACGCCGAGTTTCAAATGTCAGTCCACCCCCCTCTTAATATCTTCCCACCACGCCCA
TCATCATCAGGTCGCTGGGGCACCGCTGACAGGCCAACAGGGACTGGAAAAAGCTCACCTTCTATTATTTCGCCG
ATTCGTACATCAACTTCAATTCGCTTGTGACGGACCTTTTCAAGATATACAAGACTAGAATCTGGATGTCAGCGA
TAAACCCTGCGTCTTTTGCCAGCCCGACCCTGGGAATACAGGCGCCAAGCGGTGTCGGGCCTGGCGCCGTCGGCG
TCGGACGTGCTTCGGGCGGTGCCGAGCGTCGGCAGAACCAGCAGGCCCAAGAGCAGCAGCCGCAGGCGTTCGCCC
AGGCGCCACAGGTCGCTCGCGGATTCCGCGCCGCCTTCAACCAGCCGTTCGGGGGCGACAGGCAAGTCCCGACGG
CATCGGGATATCCAGCATCGAACTACGCTTATGGGGCGGGCGGGGCGTTTGGGAATGCCCGAGGCGGTGCGTCGT
ACGTGCCGAGCCTCTCGCCAGGCCTGGACGCATATTCCCACGCCGGCTATCAGCAGGCCGGGGACTTCCAGTCCT
TGCGCCAACGCCTGCCGCCTTCGCAGGGCGTCTCCAGTCCCGCAGCCCACACCCAGAACCTCTCGCCCCTCGGTT
CGCAGAACGATTGGACTAGCGCCTTCCAGGGGCTGTCTCTCAACACGCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail