Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3493
Gene name
LocationContig_1914:883..3359
Strand+
Gene length (bp)2476
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.4E-09 75 317
PF00067 p450 Cytochrome P450 1.4E-25 413 570
PF00067 p450 Cytochrome P450 3.3E-09 652 691

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 414 575 4.0E-19
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 414 575 2.0E-17
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 414 575 9.0E-17
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 414 575 3.0E-16
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 414 575 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 414 575 4.0E-19
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 414 575 2.0E-17
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 414 575 9.0E-17
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 414 575 3.0E-16
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 414 575 5.0E-16
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 414 575 7.0E-16
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 414 575 1.0E-15
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 414 575 1.0E-15
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 414 575 1.0E-15
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 414 575 5.0E-15
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 414 575 6.0E-15
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 414 575 7.0E-15
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 418 575 8.0E-15
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 414 575 9.0E-15
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 414 575 2.0E-14
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 414 575 3.0E-14
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 414 575 3.0E-14
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 399 575 4.0E-14
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 414 575 9.0E-14
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 403 575 1.0E-13
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 418 575 1.0E-13
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 414 575 1.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 414 575 2.0E-13
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 414 575 2.0E-13
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 414 575 3.0E-13
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 414 578 3.0E-13
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 391 576 5.0E-13
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 414 575 8.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 414 575 9.0E-13
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 414 575 1.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 416 690 1.0E-12
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 414 575 2.0E-12
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 414 575 2.0E-12
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 414 553 3.0E-12
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 414 575 3.0E-12
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 425 553 4.0E-12
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 414 572 5.0E-12
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 399 575 5.0E-12
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 405 575 6.0E-12
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 414 575 8.0E-12
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 414 544 1.0E-11
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 405 547 1.0E-11
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 401 575 1.0E-11
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 401 553 1.0E-11
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 423 690 2.0E-11
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 391 565 3.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 369 575 3.0E-11
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 405 547 4.0E-11
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 414 565 4.0E-11
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 414 565 4.0E-11
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 414 575 5.0E-11
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 401 552 5.0E-11
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 425 547 6.0E-11
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 414 577 9.0E-11
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 425 553 1.0E-10
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 356 575 1.0E-10
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 400 547 1.0E-10
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 405 547 1.0E-10
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 430 552 1.0E-10
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 405 547 1.0E-10
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 413 553 2.0E-10
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 416 690 2.0E-10
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 405 547 2.0E-10
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 417 548 2.0E-10
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 414 576 3.0E-10
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 425 547 3.0E-10
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 413 547 3.0E-10
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 414 575 3.0E-10
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 414 575 3.0E-10
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 401 552 4.0E-10
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 425 553 5.0E-10
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 413 569 5.0E-10
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 405 547 7.0E-10
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 414 565 7.0E-10
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 405 547 8.0E-10
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 376 567 8.0E-10
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 400 576 9.0E-10
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 391 545 9.0E-10
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 414 576 9.0E-10
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 414 547 1.0E-09
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 414 575 1.0E-09
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 414 565 1.0E-09
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 405 547 1.0E-09
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 414 565 1.0E-09
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 430 547 2.0E-09
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 414 576 2.0E-09
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 398 575 2.0E-09
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 414 576 2.0E-09
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 414 576 2.0E-09
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 406 576 3.0E-09
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 406 573 3.0E-09
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 414 565 3.0E-09
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 405 547 4.0E-09
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 414 574 4.0E-09
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 425 553 5.0E-09
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 417 575 6.0E-09
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 430 563 9.0E-09
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 414 571 9.0E-09
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 425 547 1.0E-08
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 418 575 1.0E-08
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 430 563 1.0E-08
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 410 567 1.0E-08
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 416 684 1.0E-08
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 406 553 1.0E-08
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 406 553 1.0E-08
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 406 553 1.0E-08
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 414 565 2.0E-08
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 404 600 2.0E-08
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 404 600 2.0E-08
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 429 576 2.0E-08
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 368 553 2.0E-08
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 319 571 2.0E-08
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 396 566 3.0E-08
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 365 566 4.0E-08
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 429 576 4.0E-08
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 417 499 4.0E-08
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 430 547 5.0E-08
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 394 565 5.0E-08
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 414 567 6.0E-08
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 417 564 8.0E-08
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 419 573 8.0E-08
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 414 565 8.0E-08
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 416 565 8.0E-08
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 417 552 1.0E-07
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 405 565 1.0E-07
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 414 565 1.0E-07
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 369 565 1.0E-07
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 415 543 1.0E-07
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 414 565 2.0E-07
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 414 571 2.0E-07
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 412 538 2.0E-07
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 403 563 2.0E-07
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 426 575 3.0E-07
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 370 553 3.0E-07
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 414 565 3.0E-07
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 414 576 3.0E-07
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 416 565 3.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 417 567 3.0E-07
sp|Q9W223|CP6D2_DROME Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 410 545 4.0E-07
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 414 575 4.0E-07
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 425 543 4.0E-07
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 401 565 4.0E-07
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 414 567 5.0E-07
sp|Q9VRB3|CP6V1_DROME Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 416 544 5.0E-07
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 419 499 5.0E-07
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 419 565 6.0E-07
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 410 567 8.0E-07
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 393 563 9.0E-07
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 414 565 9.0E-07
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 410 567 9.0E-07
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 414 576 1.0E-06
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 409 565 1.0E-06
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 414 567 1.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 416 565 1.0E-06
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 414 567 1.0E-06
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 410 567 1.0E-06
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 414 570 1.0E-06
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 410 565 2.0E-06
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 425 566 3.0E-06
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 410 567 4.0E-06
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 414 568 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3493
MQTILLVVGASVAYAVYYYVSNLLFSIAEAKRSGFNYVVVPCDPIALPWQLTHRIWMRLIMLFPESWWEEWLDLM
IPDMPFRTGFDRFRRHGEAFMVVSPRSRLLHLANAEMIRHVAMRREQFPKWTATYGILRQFGENVLTAEGQVWRA
HRKVTSASFNERNAALVFREAILQTQGMLRTWMGPTGVRPDPLRTIERDTMRLALNIIGYVGFGLRLLWPGQTLP
PGSDPTLAKYGSLEAPPGHKLSFVDTMASVMENVLVLLLTPKWLLRVLPLRRAQASADAYRDYMKYMDEMMEDKI
EEARKGDRAEEGMDLMGHLARATYGGGGGGGDGDGGDGGDGHAYGNGHHGNGNGNGHAHGNGYGNGYGKGGNEKG
NGYGKGNGNGIGNGYGKGGANGGAYGKGLKDGGGRLPVLTRDEIIGNAFIMFVAGHETTANTLHFTMVQLATNPA
AQRRLQRDIDDLVGASDPSTWDYEGLVNGMTASMLGACMYETLRIIPPAAELPKEVSPAQDQPISMDGRRYVIPR
GTIVSLAGVSVHQNPRYWPHGESRIRPGHDDLRDFRPERWFQRQQQTRQPTDTATTTTTTAVDGRRGSRGSSRGS
SRGSSPGSSPGASPGAVGVGGAGVGPGAAADTEDFGGYAGPDTNAQLFRPERGAYIPFSDGARSCLGRRIAQVEI
IAALAVLFREYSLELAVDEWAPAESVEGLPRAERRRLYGLAQDKSRATMAQASSVLTLKLHGETHVPVRVVRRGE
EQFVSWIEDS*
Coding >Hirsu2|3493
ATGCAGACCATCTTGCTCGTCGTCGGCGCGTCCGTCGCCTACGCCGTCTACTACTACGTCTCCAACCTGCTCTTC
AGCATCGCCGAGGCCAAGCGCAGCGGCTTCAACTATGTCGTCGTCCCTTGTGACCCCATTGCCCTCCCCTGGCAG
TTGACGCACCGGATATGGATGCGCCTCATCATGCTCTTCCCCGAGAGCTGGTGGGAAGAATGGCTAGACCTCATG
ATCCCCGACATGCCCTTCCGCACCGGCTTTGACCGCTTCAGGCGCCACGGCGAGGCCTTCATGGTCGTCTCGCCC
CGCTCGCGCCTGCTGCACCTGGCCAACGCCGAGATGATACGCCACGTCGCCATGCGACGCGAGCAGTTCCCCAAG
TGGACGGCCACGTACGGCATCCTGCGCCAGTTCGGCGAGAACGTCCTGACGGCCGAGGGCCAGGTCTGGCGCGCC
CACCGCAAGGTCACCTCGGCCTCCTTCAACGAGCGCAACGCCGCCCTCGTCTTCCGCGAGGCCATCCTCCAGACC
CAGGGCATGCTGCGCACCTGGATGGGGCCCACCGGCGTCCGCCCCGACCCGCTCCGCACCATCGAGCGCGACACG
ATGCGCCTCGCCCTCAACATCATCGGCTACGTCGGCTTCGGCCTGCGCCTGCTCTGGCCCGGCCAGACGCTGCCC
CCCGGCTCCGACCCGACCCTGGCCAAGTACGGCTCGCTCGAGGCGCCCCCGGGCCACAAGCTGAGCTTCGTCGAC
ACCATGGCCAGCGTCATGGAGAACGTGCTGGTGCTGCTGCTGACGCCCAAGTGGCTGCTGCGCGTTCTGCCCCTG
CGCCGCGCCCAGGCCTCGGCCGACGCCTACCGCGACTACATGAAGTACATGGACGAGATGATGGAGGACAAGATC
GAGGAGGCCCGCAAGGGCGACCGCGCCGAGGAGGGCATGGACCTCATGGGCCACCTGGCCCGGGCCACGTACGGA
GGCGGCGGCGGCGGCGGCGACGGCGACGGCGGCGACGGCGGCGACGGACACGCATACGGCAACGGCCACCACGGC
AACGGCAACGGCAACGGCCACGCACACGGCAACGGGTACGGCAACGGGTACGGCAAAGGAGGCAACGAAAAGGGG
AACGGATACGGAAAAGGAAACGGCAACGGCATCGGCAACGGATACGGAAAAGGCGGCGCAAACGGCGGGGCATAC
GGCAAGGGCCTCAAGGACGGCGGCGGCAGGCTGCCGGTGCTGACGCGCGACGAGATCATCGGCAACGCCTTCATC
ATGTTCGTCGCCGGCCACGAGACGACGGCCAACACGCTGCACTTCACCATGGTGCAGCTGGCGACCAACCCGGCC
GCCCAGCGCCGGCTGCAGCGCGACATCGACGACCTCGTCGGCGCCTCGGACCCGAGCACCTGGGACTACGAGGGC
CTGGTCAACGGCATGACGGCCAGCATGCTGGGCGCCTGCATGTACGAGACGCTGCGCATCATCCCGCCCGCCGCC
GAGCTGCCCAAGGAGGTGTCGCCGGCCCAGGACCAGCCCATCAGCATGGACGGCCGCCGCTACGTCATCCCGCGC
GGCACCATCGTCTCGCTGGCCGGCGTGTCGGTGCACCAGAACCCGCGGTACTGGCCGCACGGCGAGAGCCGCATC
CGGCCGGGCCACGACGACCTGCGCGACTTCCGGCCCGAGCGCTGGTTCCAGAGGCAGCAGCAGACGCGGCAGCCG
ACGGACACGGCCACGACGACGACGACGACGGCAGTCGACGGACGCCGCGGCAGTCGCGGTTCTAGTCGCGGCTCC
AGTCGCGGCTCCAGCCCCGGTTCCAGTCCCGGTGCCAGCCCCGGTGCCGTCGGCGTTGGCGGGGCCGGAGTGGGG
CCCGGGGCGGCGGCGGACACGGAGGACTTTGGCGGGTACGCGGGACCCGACACCAACGCGCAGCTGTTCCGGCCG
GAGCGCGGGGCCTACATCCCCTTTAGCGACGGGGCGAGGTCGTGCCTGGGGCGGCGGATCGCGCAGGTGGAGATC
ATCGCGGCGCTGGCGGTGCTGTTCCGCGAGTACAGCCTGGAGCTGGCGGTGGACGAGTGGGCGCCGGCCGAGTCG
GTCGAGGGCCTGCCGCGGGCGGAGCGGCGGCGGCTGTACGGGCTGGCGCAGGACAAGAGCCGGGCGACGATGGCG
CAGGCGAGCAGCGTGCTGACGCTCAAGCTGCACGGCGAGACGCACGTGCCGGTGCGCGTCGTGCGGCGGGGCGAG
GAGCAGTTTGTGAGCTGGATCGAGGACTCGTGA
Transcript >Hirsu2|3493
ATGCAGACCATCTTGCTCGTCGTCGGCGCGTCCGTCGCCTACGCCGTCTACTACTACGTCTCCAACCTGCTCTTC
AGCATCGCCGAGGCCAAGCGCAGCGGCTTCAACTATGTCGTCGTCCCTTGTGACCCCATTGCCCTCCCCTGGCAG
TTGACGCACCGGATATGGATGCGCCTCATCATGCTCTTCCCCGAGAGCTGGTGGGAAGAATGGCTAGACCTCATG
ATCCCCGACATGCCCTTCCGCACCGGCTTTGACCGCTTCAGGCGCCACGGCGAGGCCTTCATGGTCGTCTCGCCC
CGCTCGCGCCTGCTGCACCTGGCCAACGCCGAGATGATACGCCACGTCGCCATGCGACGCGAGCAGTTCCCCAAG
TGGACGGCCACGTACGGCATCCTGCGCCAGTTCGGCGAGAACGTCCTGACGGCCGAGGGCCAGGTCTGGCGCGCC
CACCGCAAGGTCACCTCGGCCTCCTTCAACGAGCGCAACGCCGCCCTCGTCTTCCGCGAGGCCATCCTCCAGACC
CAGGGCATGCTGCGCACCTGGATGGGGCCCACCGGCGTCCGCCCCGACCCGCTCCGCACCATCGAGCGCGACACG
ATGCGCCTCGCCCTCAACATCATCGGCTACGTCGGCTTCGGCCTGCGCCTGCTCTGGCCCGGCCAGACGCTGCCC
CCCGGCTCCGACCCGACCCTGGCCAAGTACGGCTCGCTCGAGGCGCCCCCGGGCCACAAGCTGAGCTTCGTCGAC
ACCATGGCCAGCGTCATGGAGAACGTGCTGGTGCTGCTGCTGACGCCCAAGTGGCTGCTGCGCGTTCTGCCCCTG
CGCCGCGCCCAGGCCTCGGCCGACGCCTACCGCGACTACATGAAGTACATGGACGAGATGATGGAGGACAAGATC
GAGGAGGCCCGCAAGGGCGACCGCGCCGAGGAGGGCATGGACCTCATGGGCCACCTGGCCCGGGCCACGTACGGA
GGCGGCGGCGGCGGCGGCGACGGCGACGGCGGCGACGGCGGCGACGGACACGCATACGGCAACGGCCACCACGGC
AACGGCAACGGCAACGGCCACGCACACGGCAACGGGTACGGCAACGGGTACGGCAAAGGAGGCAACGAAAAGGGG
AACGGATACGGAAAAGGAAACGGCAACGGCATCGGCAACGGATACGGAAAAGGCGGCGCAAACGGCGGGGCATAC
GGCAAGGGCCTCAAGGACGGCGGCGGCAGGCTGCCGGTGCTGACGCGCGACGAGATCATCGGCAACGCCTTCATC
ATGTTCGTCGCCGGCCACGAGACGACGGCCAACACGCTGCACTTCACCATGGTGCAGCTGGCGACCAACCCGGCC
GCCCAGCGCCGGCTGCAGCGCGACATCGACGACCTCGTCGGCGCCTCGGACCCGAGCACCTGGGACTACGAGGGC
CTGGTCAACGGCATGACGGCCAGCATGCTGGGCGCCTGCATGTACGAGACGCTGCGCATCATCCCGCCCGCCGCC
GAGCTGCCCAAGGAGGTGTCGCCGGCCCAGGACCAGCCCATCAGCATGGACGGCCGCCGCTACGTCATCCCGCGC
GGCACCATCGTCTCGCTGGCCGGCGTGTCGGTGCACCAGAACCCGCGGTACTGGCCGCACGGCGAGAGCCGCATC
CGGCCGGGCCACGACGACCTGCGCGACTTCCGGCCCGAGCGCTGGTTCCAGAGGCAGCAGCAGACGCGGCAGCCG
ACGGACACGGCCACGACGACGACGACGACGGCAGTCGACGGACGCCGCGGCAGTCGCGGTTCTAGTCGCGGCTCC
AGTCGCGGCTCCAGCCCCGGTTCCAGTCCCGGTGCCAGCCCCGGTGCCGTCGGCGTTGGCGGGGCCGGAGTGGGG
CCCGGGGCGGCGGCGGACACGGAGGACTTTGGCGGGTACGCGGGACCCGACACCAACGCGCAGCTGTTCCGGCCG
GAGCGCGGGGCCTACATCCCCTTTAGCGACGGGGCGAGGTCGTGCCTGGGGCGGCGGATCGCGCAGGTGGAGATC
ATCGCGGCGCTGGCGGTGCTGTTCCGCGAGTACAGCCTGGAGCTGGCGGTGGACGAGTGGGCGCCGGCCGAGTCG
GTCGAGGGCCTGCCGCGGGCGGAGCGGCGGCGGCTGTACGGGCTGGCGCAGGACAAGAGCCGGGCGACGATGGCG
CAGGCGAGCAGCGTGCTGACGCTCAAGCTGCACGGCGAGACGCACGTGCCGGTGCGCGTCGTGCGGCGGGGCGAG
GAGCAGTTTGTGAGCTGGATCGAGGACTCGTGA
Gene >Hirsu2|3493
ATGCAGACCATCTTGCTCGTCGTCGGCGCGTCCGTCGCCTACGCCGTCTACTACTACGTCTCCAACCTGCTCTTC
AGCATCGCCGAGGCCAAGCGCAGCGGCTTCAACTATGTCGTCGTCCGTACGTCCCATCTCCCTCTTGACGGAAAT
AAAGCATCCCGCTCCCTCTGAGGGAAATCAAGGTCCCCTCTCCTTGTAGGGGAACAAAGCTTCGAGCCCTCGCTA
ACCCCCCTCGCCTTCTGCTCCCCACAGCTTGTGACCCCATTGCCCTCCCCTGGCAGTTGACGCACCGGATATGGA
TGCGCCTCATCATGCTCTTCCCCGAGAGCTGGTGGGAAGAATGGCTAGAGTATGGCCTCCCGCCCCGCGAGACGA
GAAGCGTCGGCTGACCGGGCCCGACGACGCGCACAGCCTCATGATCCCCGACATGCCCTTCCGCACCGGCTTTGA
CCGCTTCAGGCGCCACGGCGAGGCCTTCATGGTCGTCTCGCCCCGCTCGCGCCTGCTGCACCTGGCCAACGCCGA
GATGATACGCCACGTCGCCATGCGACGCGAGCAGTTCCCCAAGTGGACGGCCACGTACGGCATCCTGCGCCAGTT
CGGCGAGAACGTCCTGACGGCCGAGGGCCAGGTCTGGCGCGCCCACCGCAAGGTCACCTCGGCCTCCTTCAACGA
GCGCAACGCCGCCCTCGTCTTCCGCGAGGCCATCCTCCAGACCCAGGGCATGCTGCGCACCTGGATGGGGCCCAC
CGGCGTCCGCCCCGACCCGCTCCGCACCATCGAGCGCGACACGATGCGCCTCGCCCTCAACATCATCGGCTACGT
CGGCTTCGGCCTGCGCCTGCTCTGGCCCGGCCAGACGCTGCCCCCCGGCTCCGACCCGACCCTGGCCAAGTACGG
CTCGCTCGAGGCGCCCCCGGGCCACAAGCTGAGCTTCGTCGACACCATGGCCAGCGTCATGGAGAACGTGCTGGT
GCTGCTGCTGACGCCCAAGTGGCTGCTGCGCGTTCTGCCCCTGCGCCGCGCCCAGGCCTCGGCCGACGCCTACCG
CGACTACATGAAGTACATGGACGAGATGATGGAGGACAAGATCGAGGAGGCCCGCAAGGGCGACCGCGCCGAGGA
GGGCATGGACCTCATGGGCCACCTGGCCCGGGCCACGTACGGAGGCGGCGGCGGCGGCGGCGACGGCGACGGCGG
CGACGGCGGCGACGGACACGCATACGGCAACGGCCACCACGGCAACGGCAACGGCAACGGCCACGCACACGGCAA
CGGGTACGGCAACGGGTACGGCAAAGGAGGCAACGAAAAGGGGAACGGATACGGAAAAGGAAACGGCAACGGCAT
CGGCAACGGATACGGAAAAGGCGGCGCAAACGGCGGGGCATACGGCAAGGGCCTCAAGGACGGCGGCGGCAGGCT
GCCGGTGCTGACGCGCGACGAGATCATCGGCAACGCCTTCATCATGTTCGTCGCCGGCCACGAGACGACGGCCAA
CACGCTGCACTTCACCATGGTGCAGCTGGCGACCAACCCGGCCGCCCAGCGCCGGCTGCAGCGCGACATCGACGA
CCTCGTCGGCGCCTCGGACCCGAGCACCTGGGACTACGAGGGCCTGGTCAACGGCATGACGGCCAGCATGCTGGG
CGCCTGCATGTACGAGACGCTGCGCATCATCCCGCCCGCCGCCGAGCTGCCCAAGGAGGTGTCGCCGGCCCAGGA
CCAGCCCATCAGCATGGACGGCCGCCGCTACGTCATCCCGCGCGGCACCATCGTCTCGCTGGCCGGCGTGTCGGT
GCACCAGAACCCGCGGTACTGGCCGCACGGCGAGAGCCGCATCCGGCCGGGCCACGACGACCTGCGCGACTTCCG
GCCCGAGCGCTGGTTCCAGAGGCAGCAGCAGACGCGGCAGCCGACGGACACGGCCACGACGACGACGACGACGGC
AGTCGACGGACGCCGCGGCAGTCGCGGTTCTAGTCGCGGCTCCAGTCGCGGCTCCAGCCCCGGTTCCAGTCCCGG
TGCCAGCCCCGGTGCCGTCGGCGTTGGCGGGGCCGGAGTGGGGCCCGGGGCGGCGGCGGACACGGAGGACTTTGG
CGGGTACGCGGGACCCGACACCAACGCGCAGCTGTTCCGGCCGGAGCGCGGGGCCTACATCCCCTTTAGCGACGG
GGCGAGGTCGTGCCTGGGGCGGCGGATCGCGCAGGTGGAGATCATCGCGGCGCTGGCGGTGCTGTTCCGCGAGTA
CAGCCTGGAGCTGGCGGTGGACGAGTGGGCGCCGGCCGAGTCGGTCGAGGGCCTGCCGCGGGCGGAGCGGCGGCG
GCTGTACGGGCTGGCGCAGGACAAGAGCCGGGCGACGATGGCGCAGGCGAGCAGCGTGCTGACGCTCAAGCTGCA
CGGCGAGACGCACGTGCCGGTGCGCGTCGTGCGGCGGGGCGAGGAGCAGTTTGTGAGCTGGATCGAGGACTCGTG
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail