Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3492
Gene name
LocationContig_1913:2476..3480
Strand+
Gene length (bp)1004
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06220 zf-U1 U1 zinc finger 8.8E-22 1 38

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YRT4|RU1C_NECH7 U1 small nuclear ribonucleoprotein C OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_80502 PE=3 SV=1 1 73 2.0E-49
sp|Q1K7T5|RU1C_NEUCR U1 small nuclear ribonucleoprotein C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU01341 PE=3 SV=1 1 73 3.0E-48
sp|A7EYK3|RU1C_SCLS1 U1 small nuclear ribonucleoprotein C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10419 PE=3 SV=1 1 69 1.0E-39
sp|D5GDH4|RU1C_TUBMM U1 small nuclear ribonucleoprotein C OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00001021001 PE=3 SV=1 1 62 2.0E-39
sp|Q5BBX9|RU1C_EMENI U1 small nuclear ribonucleoprotein C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1951 PE=3 SV=2 1 69 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YRT4|RU1C_NECH7 U1 small nuclear ribonucleoprotein C OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_80502 PE=3 SV=1 1 73 2.0E-49
sp|Q1K7T5|RU1C_NEUCR U1 small nuclear ribonucleoprotein C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU01341 PE=3 SV=1 1 73 3.0E-48
sp|A7EYK3|RU1C_SCLS1 U1 small nuclear ribonucleoprotein C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10419 PE=3 SV=1 1 69 1.0E-39
sp|D5GDH4|RU1C_TUBMM U1 small nuclear ribonucleoprotein C OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00001021001 PE=3 SV=1 1 62 2.0E-39
sp|Q5BBX9|RU1C_EMENI U1 small nuclear ribonucleoprotein C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1951 PE=3 SV=2 1 69 1.0E-38
sp|Q4WQM6|RU1C_ASPFU U1 small nuclear ribonucleoprotein C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13350 PE=3 SV=3 1 63 5.0E-38
sp|C0NN85|RU1C_AJECG U1 small nuclear ribonucleoprotein C OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_04212 PE=3 SV=1 4 71 1.0E-37
sp|A8NYM5|RU1C_COPC7 U1 small nuclear ribonucleoprotein C OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_01380 PE=3 SV=1 1 59 3.0E-26
sp|E3LAN7|RU1C1_PUCGT U1 small nuclear ribonucleoprotein C-1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_19611 PE=3 SV=1 1 169 3.0E-23
sp|E3KIY6|RU1C2_PUCGT U1 small nuclear ribonucleoprotein C-2 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_10639 PE=3 SV=1 1 169 3.0E-23
sp|Q5KC16|RU1C_CRYNJ U1 small nuclear ribonucleoprotein C OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNI00630 PE=3 SV=1 1 62 9.0E-22
sp|Q4P2Q5|RU1C_USTMA U1 small nuclear ribonucleoprotein C OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_05608 PE=3 SV=1 1 69 4.0E-21
sp|Q8JGS0|RU1C_DANRE U1 small nuclear ribonucleoprotein C OS=Danio rerio GN=snrpc PE=2 SV=1 1 57 5.0E-21
sp|F7ARS3|RU1C_MONDO U1 small nuclear ribonucleoprotein C OS=Monodelphis domestica GN=SNRPC PE=3 SV=1 1 57 6.0E-21
sp|F6TFD9|RU1C_MACMU U1 small nuclear ribonucleoprotein C OS=Macaca mulatta GN=SNRPC PE=3 SV=1 1 57 8.0E-21
sp|Q32PA0|RU1C_BOVIN U1 small nuclear ribonucleoprotein C OS=Bos taurus GN=SNRPC PE=2 SV=2 1 57 8.0E-21
sp|E2RGI3|RU1C_CANLF U1 small nuclear ribonucleoprotein C OS=Canis lupus familiaris GN=SNRPC PE=3 SV=1 1 57 8.0E-21
sp|P09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C OS=Homo sapiens GN=SNRPC PE=1 SV=1 1 57 8.0E-21
sp|E1C6F0|RU1C_CHICK U1 small nuclear ribonucleoprotein C OS=Gallus gallus GN=SNRPC PE=3 SV=1 1 57 9.0E-21
sp|B0JYS7|RU1C_XENTR U1 small nuclear ribonucleoprotein C OS=Xenopus tropicalis GN=snrpc PE=2 SV=1 1 57 1.0E-20
sp|Q03369|RU1C_XENLA U1 small nuclear ribonucleoprotein C OS=Xenopus laevis GN=snrpc PE=2 SV=1 1 57 1.0E-20
sp|D3ZCL3|RU1C_RAT U1 small nuclear ribonucleoprotein C OS=Rattus norvegicus GN=Snrpc PE=3 SV=1 1 57 1.0E-20
sp|Q62241|RU1C_MOUSE U1 small nuclear ribonucleoprotein C OS=Mus musculus GN=Snrpc PE=1 SV=1 1 57 1.0E-20
sp|E3X5D6|RU1C_ANODA U1 small nuclear ribonucleoprotein C OS=Anopheles darlingi GN=AND_14095 PE=3 SV=1 1 67 5.0E-20
sp|Q7PXU6|RU1C_ANOGA U1 small nuclear ribonucleoprotein C OS=Anopheles gambiae GN=AGAP001584 PE=3 SV=2 1 59 7.0E-20
sp|C3Z1P5|RU1C_BRAFL U1 small nuclear ribonucleoprotein C OS=Branchiostoma floridae GN=BRAFLDRAFT_69314 PE=3 SV=1 1 159 7.0E-20
sp|Q298E0|RU1C_DROPS U1 small nuclear ribonucleoprotein C OS=Drosophila pseudoobscura pseudoobscura GN=snRNP-U1-C PE=3 SV=1 1 67 5.0E-19
sp|A7SEP9|RU1C_NEMVE U1 small nuclear ribonucleoprotein C OS=Nematostella vectensis GN=v1g244745 PE=3 SV=1 1 60 5.0E-19
sp|Q9P794|RU1C_SCHPO U1 small nuclear ribonucleoprotein C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp103 PE=1 SV=1 1 56 6.0E-19
sp|C5XZK6|RU1C1_SORBI U1 small nuclear ribonucleoprotein C-1 OS=Sorghum bicolor GN=Sb04g009880 PE=3 SV=1 1 101 6.0E-19
sp|Q16IW3|RU1C_AEDAE U1 small nuclear ribonucleoprotein C OS=Aedes aegypti GN=AAEL013527 PE=3 SV=1 1 102 1.0E-18
sp|Q1RLC9|RU1C_CIOIN U1 small nuclear ribonucleoprotein C OS=Ciona intestinalis PE=2 SV=1 1 57 1.0E-18
sp|E0VI98|RU1C_PEDHC U1 small nuclear ribonucleoprotein C OS=Pediculus humanus subsp. corporis GN=PHUM222080 PE=3 SV=1 1 59 2.0E-18
sp|Q9VE17|RU1C_DROME U1 small nuclear ribonucleoprotein C OS=Drosophila melanogaster GN=snRNP-U1-C PE=1 SV=1 1 59 2.0E-18
sp|C5XYW4|RU1C2_SORBI U1 small nuclear ribonucleoprotein C-2 OS=Sorghum bicolor GN=Sb04g028260 PE=3 SV=1 1 57 9.0E-18
sp|F6HQ26|RU1C_VITVI U1 small nuclear ribonucleoprotein C OS=Vitis vinifera GN=VIT_07s0104g01170 PE=3 SV=1 1 63 1.0E-17
sp|A8XW44|RU1C_CAEBR U1 small nuclear ribonucleoprotein C OS=Caenorhabditis briggsae GN=CBG19656 PE=3 SV=1 1 59 1.0E-16
sp|B7Q2M2|RU1C_IXOSC U1 small nuclear ribonucleoprotein C OS=Ixodes scapularis GN=ISCW020627 PE=3 SV=1 3 107 1.0E-16
sp|P90815|RU1C_CAEEL U1 small nuclear ribonucleoprotein C OS=Caenorhabditis elegans GN=F08B4.7 PE=3 SV=1 1 59 1.0E-16
sp|Q56XE4|RU1C_ARATH U1 small nuclear ribonucleoprotein C OS=Arabidopsis thaliana GN=At4g03120 PE=2 SV=1 1 60 2.0E-16
sp|Q54YA5|RU1C_DICDI U1 small nuclear ribonucleoprotein C OS=Dictyostelium discoideum GN=snrpC PE=3 SV=1 1 59 5.0E-14
sp|C4YIU5|RU1C_CANAW U1 small nuclear ribonucleoprotein C OS=Candida albicans (strain WO-1) GN=YHC1 PE=3 SV=1 1 44 3.0E-13
sp|Q59P44|RU1C_CANAL U1 small nuclear ribonucleoprotein C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YHC1 PE=3 SV=1 1 44 3.0E-13
sp|Q05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHC1 PE=1 SV=1 1 51 9.0E-13
sp|F4NYQ2|RU1C_BATDJ U1 small nuclear ribonucleoprotein C OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_23335 PE=3 SV=1 7 61 1.0E-12
sp|D0NHA2|RU1C_PHYIT U1 small nuclear ribonucleoprotein C OS=Phytophthora infestans (strain T30-4) GN=PITG_10871 PE=3 SV=1 1 41 2.0E-11
sp|D3B3B7|RU1C_POLPA U1 small nuclear ribonucleoprotein C OS=Polysphondylium pallidum GN=snrpC PE=3 SV=1 1 52 2.0E-11
sp|Q4N6K2|RU1C_THEPA U1 small nuclear ribonucleoprotein C OS=Theileria parva GN=TP01_1168 PE=3 SV=1 1 45 1.0E-10
sp|Q4UJ14|RU1C_THEAN U1 small nuclear ribonucleoprotein C OS=Theileria annulata GN=TA09515 PE=3 SV=1 1 45 1.0E-10
sp|Q4XRM7|RU1C_PLACH U1 small nuclear ribonucleoprotein C OS=Plasmodium chabaudi GN=PC000036.04.0 PE=3 SV=1 1 45 5.0E-09
sp|Q4YBG7|RU1C_PLABA U1 small nuclear ribonucleoprotein C OS=Plasmodium berghei (strain Anka) GN=PB001431.02.0 PE=3 SV=1 1 180 6.0E-09
sp|Q7RNM5|RU1C_PLAYO U1 small nuclear ribonucleoprotein C OS=Plasmodium yoelii yoelii GN=PY01791 PE=3 SV=1 1 45 7.0E-09
sp|B3LC82|RU1C_PLAKH U1 small nuclear ribonucleoprotein C OS=Plasmodium knowlesi (strain H) GN=PKH_142590 PE=3 SV=1 1 110 2.0E-08
sp|A5JZQ2|RU1C_PLAVS U1 small nuclear ribonucleoprotein C OS=Plasmodium vivax (strain Salvador I) GN=PVX_123135 PE=3 SV=1 1 107 2.0E-08
sp|Q8IAW3|RU1C_PLAF7 U1 small nuclear ribonucleoprotein C OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0084 PE=3 SV=1 1 45 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5081 0.8606 0.0459 0.009 0.0951 0.0006 0.1793 0.027 0.0305 0.0276

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5135
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6299
Ophiocordyceps australis map64 (Brazil) OphauB2|5284
Ophiocordyceps camponoti-floridani Ophcf2|02086
Ophiocordyceps kimflemingae Ophio5|4595
Ophiocordyceps subramaniannii Hirsu2|3492 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3492
MPKFFCDYCDVYLTHDSLSVRKAHNSGRNHLRNVVDYYQQIGHEKAQSVIDSITSSYAAEGQAHANPMLPQNQPG
FPAPPGFPAFPGGGAPPPFPGMPGAPPGSFPLGVPPPPNAAGRGMPPMPPFPPGPNGMPAMPPPGGLPFTPPPGG
FPPFPPPPGPNGVPGGPLPNFPGMPNMPPPPGHSFPPGAGPLPSGFPQARSPPPGQERR*
Coding >Hirsu2|3492
ATGCCTAAATTCTTTTGCGACTATTGCGACGTCTACCTCACCCACGACTCCTTGAGCGTGCGGAAAGCCCACAAC
AGCGGCCGTAACCACCTTCGCAATGTGGTAGACTACTACCAGCAAATCGGCCACGAAAAGGCCCAGTCGGTCATC
GACTCCATCACCTCGTCCTACGCCGCCGAGGGCCAGGCCCACGCCAACCCCATGCTGCCCCAGAACCAGCCGGGC
TTCCCCGCGCCGCCGGGCTTCCCTGCCTTCCCAGGTGGTGGAGCGCCGCCCCCGTTCCCCGGAATGCCGGGCGCG
CCCCCGGGCTCGTTCCCGCTCGGCGTCCCGCCTCCCCCCAACGCCGCGGGCCGAGGCATGCCGCCCATGCCGCCC
TTCCCGCCCGGCCCCAACGGCATGCCCGCCATGCCGCCGCCCGGCGGCCTCCCCTTCACGCCCCCGCCCGGCGGC
TTCCCGCCCTTCCCGCCCCCGCCGGGCCCCAACGGCGTGCCCGGCGGCCCCCTGCCCAACTTCCCGGGCATGCCC
AACATGCCTCCGCCCCCGGGACACAGCTTCCCGCCCGGAGCCGGCCCGCTGCCCTCGGGCTTCCCGCAGGCGAGA
TCGCCGCCGCCGGGCCAGGAGAGACGCTAG
Transcript >Hirsu2|3492
ATGCCTAAATTCTTTTGCGACTATTGCGACGTCTACCTCACCCACGACTCCTTGAGCGTGCGGAAAGCCCACAAC
AGCGGCCGTAACCACCTTCGCAATGTGGTAGACTACTACCAGCAAATCGGCCACGAAAAGGCCCAGTCGGTCATC
GACTCCATCACCTCGTCCTACGCCGCCGAGGGCCAGGCCCACGCCAACCCCATGCTGCCCCAGAACCAGCCGGGC
TTCCCCGCGCCGCCGGGCTTCCCTGCCTTCCCAGGTGGTGGAGCGCCGCCCCCGTTCCCCGGAATGCCGGGCGCG
CCCCCGGGCTCGTTCCCGCTCGGCGTCCCGCCTCCCCCCAACGCCGCGGGCCGAGGCATGCCGCCCATGCCGCCC
TTCCCGCCCGGCCCCAACGGCATGCCCGCCATGCCGCCGCCCGGCGGCCTCCCCTTCACGCCCCCGCCCGGCGGC
TTCCCGCCCTTCCCGCCCCCGCCGGGCCCCAACGGCGTGCCCGGCGGCCCCCTGCCCAACTTCCCGGGCATGCCC
AACATGCCTCCGCCCCCGGGACACAGCTTCCCGCCCGGAGCCGGCCCGCTGCCCTCGGGCTTCCCGCAGGCGAGA
TCGCCGCCGCCGGGCCAGGAGAGACGCTAG
Gene >Hirsu2|3492
ATGCCTAAATGTGAGTCCCCTGACCCAATCTCTCGGCTTCCCGACAACATGGCATCTTGCTCATGCAGCTTGGCT
AACGCCGCGGATTAAACTAGTCTTTTGTGAGCTTCCCTCCCTCCTCCGCCTCCTCCATCTCGCCCCGAAAAGGAA
GAGGATGGGCCAAAAAAAAAACCCCGATGATTAACGGCGGTTTGCAGGCGACTATTGCGACGTCTACCTCACCCA
CGACTCCTTGAGCGTGCGGAAAGCCCACAACAGCGGCCGTAACCACCTTCGCAATGTGGTAGACTACTACCAGCG
TGAGTCCAGCCTCTCGCGCCTCCTCCCCGTTTGCCTAGCCGACGCCTCTCTCTACAGAAATCGGCCACGAAAAGG
CCCAGTCGGTCATCGACTCCATCACCTCGTCCTACGCCGCCGAGGGCCAGGCCCACGCCAACCCCATGCTGCCCC
AGAACCAGCCGGGCTTCCCCGCGCCGCCGGGCTTCCCTGCCTTCCCAGGTGGCACACCACCTCCCGCCTCGCCCG
AGAGGGCCGAGAGAGAGCGCGCGCTGACTGAAGATGCCTCAGGTGGTGGAGCGCCGCCCCCGTTCCCCGGAATGC
CGGGCGCGCCCCCGGGCTCGTTCCCGCTCGGCGTCCCGCGTACGTCGCACCCTTCGGGACCGTGCCGCCTGGTCG
ACGCTGCTGCTGACACTGGACGCTTCCCAGCTCCCCCCAACGCCGCGGGCCGAGGCATGCCGCCCATGCCGCCCT
TCCCGCCCGGCCCCAACGGCATGCCCGCCATGCCGCCGCCCGGCGGCCTCCCCTTCACGCCCCCGCCCGGCGGCT
TCCCGCCCTTCCCGCCCCCGCCGGGCCCCAACGGCGTGCCCGGCGGCCCCCTGCCCAACTTCCCGGGCATGCCCA
ACATGCCTCCGCCCCCGGGACACAGCTTCCCGCCCGGAGCCGGCCCGCTGCCCTCGGGCTTCCCGCAGGCGAGAT
CGCCGCCGCCGGGCCAGGAGAGACGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail