Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|349
Gene name
LocationContig_1067:5754..9143
Strand+
Gene length (bp)3389
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02862 DDHD DDHD domain 2.2E-75 653 952

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87109|YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.02 PE=3 SV=1 65 864 1.0E-89
sp|Q12204|YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR022C PE=1 SV=1 69 837 5.0E-71
sp|Q7LKZ6|YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.13c PE=3 SV=1 444 767 5.0E-28
sp|O46606|DDHD1_BOVIN Phospholipase DDHD1 OS=Bos taurus GN=DDHD1 PE=1 SV=1 448 951 1.0E-24
sp|Q8NEL9|DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens GN=DDHD1 PE=1 SV=2 448 951 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87109|YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.02 PE=3 SV=1 65 864 1.0E-89
sp|Q12204|YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR022C PE=1 SV=1 69 837 5.0E-71
sp|Q7LKZ6|YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.13c PE=3 SV=1 444 767 5.0E-28
sp|O46606|DDHD1_BOVIN Phospholipase DDHD1 OS=Bos taurus GN=DDHD1 PE=1 SV=1 448 951 1.0E-24
sp|Q8NEL9|DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens GN=DDHD1 PE=1 SV=2 448 951 6.0E-24
sp|O94830|DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens GN=DDHD2 PE=1 SV=2 415 766 8.0E-24
sp|Q80Y98|DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus GN=Ddhd2 PE=1 SV=3 415 766 1.0E-23
sp|Q80YA3|DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus GN=Ddhd1 PE=1 SV=1 448 949 2.0E-23
sp|Q6NZC7|S23IP_MOUSE SEC23-interacting protein OS=Mus musculus GN=Sec23ip PE=1 SV=2 415 624 5.0E-18
sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens GN=SEC23IP PE=1 SV=1 415 624 2.0E-17
sp|Q8W5R2|SHGR2_ARATH Phospholipase SGR2 OS=Arabidopsis thaliana GN=SGR2 PE=1 SV=1 418 622 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Endoplasmic reticulum|Lysosome/Vacuole|Golgi apparatus Signal peptide 0.4695 0.2213 0.3504 0.1516 0.406 0.0504 0.661 0.6094 0.8213 0.0992

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup800
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2809
Ophiocordyceps australis 1348a (Ghana) OphauG2|4878
Ophiocordyceps australis map64 (Brazil) OphauB2|6337
Ophiocordyceps camponoti-floridani Ophcf2|02491
Ophiocordyceps camponoti-rufipedis Ophun1|4059
Ophiocordyceps kimflemingae Ophio5|473
Ophiocordyceps subramaniannii Hirsu2|349 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|349
MPPASGDKKPEKSYLTSAVESINPWAASRTTTPTPDNKRDELPAASGDHSVTPLYGQSFRTYPKDCPPLNVQWFH
AVDVPKRKPQLIKGRQPLPKDTKPPVAPKKFTAFASSDSRRLEGRYQKLLEAAEDGHGLPSKPSTTDSPDRDAKP
GNGPSSAARVPVNEDFLFDVDIEERELSPVYWLGPVYEVRRGTWFFQEGSNLRPCEENLAAQLEEGYLKMKPWLN
PVPSRNQPGSKESGTQTPQDDSESQAALASATSKPPPETPSAPTAASQPTLQPQPYRLFGAYMSNVATYQDATTA
WLSTDGVLSWVTTSVYERFAGGGYLSGVKLIRGYTEPNKAKDKEDKGQGSSTHSPLDDSDERQQRTLKRKTAPHS
SRDSSSDSNHKSDDSNQPDIRQLKLQRQLSSLMESEGNDGASTEEQIRKRDEQEIQDDYNAQAGEAQGREIEHLV
LVTHGIGQRLGLRMESVNFVHDANVLRKTLKSVYTNSADLKALNSELHAGPGNCRVQVLPVCWRHLIEFPRQRQR
KGEHDLGDVEGEEDGYPSLEDITVEGVAFARSLISDLALDVLLYQSSYRDEISKVVVGETNRIVKLFRERNPDFK
GQVHLMGHSLGSAIFFDVLCHQRERQDEHRHTLRMWPHQGRPASRAKDGELQFDFDVHNYFCLGSPVGLFQMLKG
RTIAARPAAVGLPPENALRADGTKDPFLASQTASTAERISPVDGLPARVSSPRVRQLFNIFHPSDPVSYRLEPLI
SPAMATLKPQALPYTKKGLFGNVAPQGLTGIGAKVGQSVSGLWSSLSAGIASNLLNRSLGLSNEEVTRMAAGETA
ARQADGAEAEGRKQQLADSAAAGQHNATLIDDELETLYSTFQRSRTAGPRDGEEEAAAAATKAGDESRRARKLRG
EETKVRALNRNGRVDYSIQESALDFNPINTIASHMGYWADDDVNHFILSQLLSSRARGGTPGRHGRG*
Coding >Hirsu2|349
ATGCCTCCCGCCAGCGGCGACAAGAAGCCCGAGAAGTCGTACCTGACGTCGGCCGTCGAGTCCATCAATCCCTGG
GCTGCCAGCCGAACCACGACGCCCACGCCCGACAACAAGCGCGATGAGCTGCCCGCCGCTTCCGGCGACCACAGC
GTGACGCCCCTGTACGGACAGAGCTTCCGCACCTATCCCAAGGACTGCCCGCCGCTCAACGTCCAGTGGTTCCAT
GCCGTCGACGTGCCCAAGCGCAAGCCCCAGCTCATCAAGGGCCGCCAGCCTCTCCCGAAGGATACCAAGCCTCCC
GTGGCTCCCAAGAAATTTACCGCCTTCGCCTCTTCCGACTCGAGAAGGCTGGAAGGCCGCTACCAGAAGCTCCTG
GAGGCTGCAGAAGACGGCCATGGCTTGCCCTCGAAACCATCGACAACAGACAGCCCAGACCGCGACGCCAAACCC
GGAAATGGCCCCTCGTCGGCTGCCCGCGTGCCCGTCAACGAGGACTTCCTGTTCGACGTCGACATCGAGGAGCGC
GAGCTCTCTCCGGTTTACTGGCTGGGGCCCGTCTACGAAGTTCGTCGCGGAACCTGGTTCTTTCAAGAGGGCTCG
AATCTGCGCCCGTGCGAAGAGAACCTTGCAGCCCAACTGGAAGAGGGATACCTCAAGATGAAGCCATGGCTGAAT
CCAGTGCCGTCGCGGAACCAGCCCGGTTCCAAGGAGTCCGGGACGCAAACACCCCAGGACGATTCTGAATCTCAG
GCTGCTCTCGCGTCCGCGACCTCCAAGCCTCCTCCAGAAACACCGTCTGCACCGACGGCCGCCTCGCAGCCAACC
CTGCAGCCACAGCCCTATCGGCTGTTCGGCGCCTACATGAGTAACGTGGCCACCTACCAAGACGCGACTACGGCT
TGGCTTTCTACCGATGGCGTTCTGTCTTGGGTCACGACGTCAGTCTACGAAAGATTTGCCGGCGGCGGCTACCTG
AGCGGCGTGAAGCTGATCAGGGGCTACACCGAACCCAACAAGGCCAAGGACAAGGAGGACAAAGGTCAGGGATCG
TCGACCCATAGCCCCCTCGACGACTCGGATGAGCGCCAGCAGAGGACCTTGAAGCGAAAGACGGCGCCCCACTCG
AGTAGAGATTCTAGTAGCGACTCAAACCACAAGTCGGATGATTCGAACCAGCCAGATATCCGGCAGCTGAAGCTG
CAGCGACAGCTCTCGTCTCTGATGGAGAGTGAAGGCAACGACGGTGCCTCGACGGAAGAACAGATTCGAAAGCGC
GATGAGCAAGAAATCCAGGACGACTACAACGCGCAGGCGGGCGAGGCCCAGGGCCGCGAAATCGAGCATCTGGTC
CTCGTCACCCACGGCATAGGACAGCGCCTCGGCCTTCGGATGGAGAGCGTCAACTTCGTCCACGACGCCAACGTG
CTGCGTAAGACGCTCAAGTCCGTCTACACGAACTCGGCCGACTTGAAAGCTCTCAACTCGGAGCTCCATGCCGGG
CCCGGAAACTGCCGGGTCCAGGTTCTTCCTGTGTGCTGGAGACATCTGATCGAATTCCCGCGGCAGCGCCAGCGG
AAAGGCGAGCATGACTTGGGAGACGTCGAAGGGGAAGAAGATGGATATCCGTCCTTGGAGGACATCACGGTCGAA
GGCGTGGCCTTTGCCCGGTCGCTCATCTCGGACCTGGCCCTCGACGTCCTGCTGTACCAGAGCTCGTACCGCGAC
GAGATCTCGAAAGTCGTGGTTGGCGAAACGAACCGCATAGTGAAGCTCTTTCGAGAGCGCAACCCCGATTTCAAG
GGCCAGGTGCATCTCATGGGCCATTCGCTCGGCTCCGCCATCTTCTTCGACGTCCTGTGTCACCAAAGGGAACGG
CAGGACGAGCACAGGCATACCCTGCGCATGTGGCCCCATCAAGGACGGCCGGCGAGCCGGGCCAAGGACGGCGAG
CTGCAGTTTGATTTCGACGTGCACAACTACTTTTGCCTCGGGTCCCCGGTCGGACTGTTCCAGATGCTCAAGGGG
CGGACCATCGCGGCCCGGCCTGCAGCGGTCGGCCTGCCGCCGGAGAATGCGCTGCGCGCCGACGGGACGAAGGAC
CCGTTTCTGGCCTCGCAGACGGCGTCGACTGCCGAGCGCATCTCCCCCGTCGACGGACTGCCGGCTCGGGTGTCG
TCGCCCAGGGTCAGACAGCTGTTCAACATCTTCCACCCGTCGGACCCGGTGAGCTACCGGCTGGAGCCCCTGATA
TCGCCGGCCATGGCGACGCTCAAGCCGCAGGCGCTGCCGTACACCAAGAAGGGCCTGTTCGGCAACGTGGCGCCG
CAGGGCCTGACGGGCATCGGAGCCAAGGTCGGGCAGAGCGTCAGCGGGCTGTGGTCGAGCCTGAGCGCGGGCATC
GCGAGCAACCTGCTCAACCGCAGCCTCGGGCTCTCCAACGAGGAGGTGACGCGGATGGCGGCCGGGGAGACGGCG
GCGCGGCAGGCGGACGGGGCCGAGGCCGAGGGGCGCAAGCAGCAGCTGGCCGACTCGGCGGCGGCGGGGCAGCAC
AACGCGACGCTCATCGACGACGAGCTCGAGACGCTCTACTCGACCTTCCAGCGGAGCCGGACGGCGGGGCCGCGG
GACGGAGAGGAGGAGGCGGCGGCGGCGGCGACCAAGGCCGGCGACGAGAGCCGCCGGGCGCGCAAGCTGCGCGGC
GAGGAGACCAAGGTGCGGGCGCTGAACCGCAACGGGCGCGTCGACTACAGCATCCAGGAGAGCGCCCTCGACTTC
AACCCCATCAACACCATCGCGTCGCACATGGGCTACTGGGCCGACGACGACGTCAACCACTTCATCCTGTCGCAG
CTGCTGTCGAGCCGCGCGCGGGGCGGCACGCCGGGCCGACACGGGCGAGGCTAG
Transcript >Hirsu2|349
ATGCCTCCCGCCAGCGGCGACAAGAAGCCCGAGAAGTCGTACCTGACGTCGGCCGTCGAGTCCATCAATCCCTGG
GCTGCCAGCCGAACCACGACGCCCACGCCCGACAACAAGCGCGATGAGCTGCCCGCCGCTTCCGGCGACCACAGC
GTGACGCCCCTGTACGGACAGAGCTTCCGCACCTATCCCAAGGACTGCCCGCCGCTCAACGTCCAGTGGTTCCAT
GCCGTCGACGTGCCCAAGCGCAAGCCCCAGCTCATCAAGGGCCGCCAGCCTCTCCCGAAGGATACCAAGCCTCCC
GTGGCTCCCAAGAAATTTACCGCCTTCGCCTCTTCCGACTCGAGAAGGCTGGAAGGCCGCTACCAGAAGCTCCTG
GAGGCTGCAGAAGACGGCCATGGCTTGCCCTCGAAACCATCGACAACAGACAGCCCAGACCGCGACGCCAAACCC
GGAAATGGCCCCTCGTCGGCTGCCCGCGTGCCCGTCAACGAGGACTTCCTGTTCGACGTCGACATCGAGGAGCGC
GAGCTCTCTCCGGTTTACTGGCTGGGGCCCGTCTACGAAGTTCGTCGCGGAACCTGGTTCTTTCAAGAGGGCTCG
AATCTGCGCCCGTGCGAAGAGAACCTTGCAGCCCAACTGGAAGAGGGATACCTCAAGATGAAGCCATGGCTGAAT
CCAGTGCCGTCGCGGAACCAGCCCGGTTCCAAGGAGTCCGGGACGCAAACACCCCAGGACGATTCTGAATCTCAG
GCTGCTCTCGCGTCCGCGACCTCCAAGCCTCCTCCAGAAACACCGTCTGCACCGACGGCCGCCTCGCAGCCAACC
CTGCAGCCACAGCCCTATCGGCTGTTCGGCGCCTACATGAGTAACGTGGCCACCTACCAAGACGCGACTACGGCT
TGGCTTTCTACCGATGGCGTTCTGTCTTGGGTCACGACGTCAGTCTACGAAAGATTTGCCGGCGGCGGCTACCTG
AGCGGCGTGAAGCTGATCAGGGGCTACACCGAACCCAACAAGGCCAAGGACAAGGAGGACAAAGGTCAGGGATCG
TCGACCCATAGCCCCCTCGACGACTCGGATGAGCGCCAGCAGAGGACCTTGAAGCGAAAGACGGCGCCCCACTCG
AGTAGAGATTCTAGTAGCGACTCAAACCACAAGTCGGATGATTCGAACCAGCCAGATATCCGGCAGCTGAAGCTG
CAGCGACAGCTCTCGTCTCTGATGGAGAGTGAAGGCAACGACGGTGCCTCGACGGAAGAACAGATTCGAAAGCGC
GATGAGCAAGAAATCCAGGACGACTACAACGCGCAGGCGGGCGAGGCCCAGGGCCGCGAAATCGAGCATCTGGTC
CTCGTCACCCACGGCATAGGACAGCGCCTCGGCCTTCGGATGGAGAGCGTCAACTTCGTCCACGACGCCAACGTG
CTGCGTAAGACGCTCAAGTCCGTCTACACGAACTCGGCCGACTTGAAAGCTCTCAACTCGGAGCTCCATGCCGGG
CCCGGAAACTGCCGGGTCCAGGTTCTTCCTGTGTGCTGGAGACATCTGATCGAATTCCCGCGGCAGCGCCAGCGG
AAAGGCGAGCATGACTTGGGAGACGTCGAAGGGGAAGAAGATGGATATCCGTCCTTGGAGGACATCACGGTCGAA
GGCGTGGCCTTTGCCCGGTCGCTCATCTCGGACCTGGCCCTCGACGTCCTGCTGTACCAGAGCTCGTACCGCGAC
GAGATCTCGAAAGTCGTGGTTGGCGAAACGAACCGCATAGTGAAGCTCTTTCGAGAGCGCAACCCCGATTTCAAG
GGCCAGGTGCATCTCATGGGCCATTCGCTCGGCTCCGCCATCTTCTTCGACGTCCTGTGTCACCAAAGGGAACGG
CAGGACGAGCACAGGCATACCCTGCGCATGTGGCCCCATCAAGGACGGCCGGCGAGCCGGGCCAAGGACGGCGAG
CTGCAGTTTGATTTCGACGTGCACAACTACTTTTGCCTCGGGTCCCCGGTCGGACTGTTCCAGATGCTCAAGGGG
CGGACCATCGCGGCCCGGCCTGCAGCGGTCGGCCTGCCGCCGGAGAATGCGCTGCGCGCCGACGGGACGAAGGAC
CCGTTTCTGGCCTCGCAGACGGCGTCGACTGCCGAGCGCATCTCCCCCGTCGACGGACTGCCGGCTCGGGTGTCG
TCGCCCAGGGTCAGACAGCTGTTCAACATCTTCCACCCGTCGGACCCGGTGAGCTACCGGCTGGAGCCCCTGATA
TCGCCGGCCATGGCGACGCTCAAGCCGCAGGCGCTGCCGTACACCAAGAAGGGCCTGTTCGGCAACGTGGCGCCG
CAGGGCCTGACGGGCATCGGAGCCAAGGTCGGGCAGAGCGTCAGCGGGCTGTGGTCGAGCCTGAGCGCGGGCATC
GCGAGCAACCTGCTCAACCGCAGCCTCGGGCTCTCCAACGAGGAGGTGACGCGGATGGCGGCCGGGGAGACGGCG
GCGCGGCAGGCGGACGGGGCCGAGGCCGAGGGGCGCAAGCAGCAGCTGGCCGACTCGGCGGCGGCGGGGCAGCAC
AACGCGACGCTCATCGACGACGAGCTCGAGACGCTCTACTCGACCTTCCAGCGGAGCCGGACGGCGGGGCCGCGG
GACGGAGAGGAGGAGGCGGCGGCGGCGGCGACCAAGGCCGGCGACGAGAGCCGCCGGGCGCGCAAGCTGCGCGGC
GAGGAGACCAAGGTGCGGGCGCTGAACCGCAACGGGCGCGTCGACTACAGCATCCAGGAGAGCGCCCTCGACTTC
AACCCCATCAACACCATCGCGTCGCACATGGGCTACTGGGCCGACGACGACGTCAACCACTTCATCCTGTCGCAG
CTGCTGTCGAGCCGCGCGCGGGGCGGCACGCCGGGCCGACACGGGCGAGGCTAG
Gene >Hirsu2|349
ATGCCTCCCGCCAGCGGCGACAAGAAGCCCGAGAAGTCGTACCTGACGTCGGCCGTCGAGTCCATCAATCCCTGG
GCTGCCAGCCGAACCACGACGCCCACGCCCGACAACAAGCGCGATGAGCTGCCCGCCGCTTCCGGCGACCACAGC
GTGACGCCCCTGTACGGACAGAGCTTCCGCACCTATCCCAAGGACTGCCCGCCGCTCAACGTCCAGTGGTTCCAT
GCCGTCGACGTGCGTACGCCCCCGAGCCCGCGCCCGTTCCCGGGAACACGTCCGCCTGACATGATGGTCCGCAGG
TGCCCAAGCGCAAGCCCCAGCTCATCAAGGGCCGCCAGCCTCTCCCGAAGGATACCAAGCCTCCCGTGGCTCCCA
AGAAATTTACCGCCTTCGCCTCTTCCGACTCGAGAAGGCTGGAAGGCCGCTACCAGAAGCTCCTGGAGGCTGCAG
AAGACGGCCATGGCTTGCCCTCGAAACCATCGACAACAGACAGCCCAGACCGCGACGCCAAACCCGGAAATGGCC
CCTCGTCGGCTGCCCGCGTGCCCGTCAACGAGGACTTCCTGTTCGACGTCGACATCGAGGAGCGCGAGCTCTCTC
CGGTTTACTGGCTGGGGCCCGTCTACGAAGGTGAGATGCGGCAACTTGGGCAAGAGCCTGATATCACCGTCAGCC
TGCTGACGCGCTGCAAAGTTCGTCGCGGAACCTGGTTCTTTCAAGAGGGCTCGAATCTGCGCCCGTGCGAAGAGA
ACCTTGCAGCCCAACTGGAAGAGGTAGGTCCGGGCCGAGGAGCTGCATCCGTGGTCCGGGCGCTAAGAAGCCTCA
TCTAGGGATACCTCAAGATGAAGCCATGGCTGAATCCAGGTTGGCCGGCTCTGAGAACTACCCACGCTTGCAATT
CTGCTGCTGACCACGTCAATCGGCAGTGCCGTCGCGGAACCAGCCCGGTTCCAAGGAGTCCGGGACGCAAACACC
CCAGGACGATTCTGAATCTCAGGCTGCTCTCGCGTCCGCGACCTCCAAGCCTCCTCCAGAAACACCGTCTGCACC
GACGGCCGCCTCGCAGCCAACCCTGCAGCCACAGCCCTATCGGCTGTTCGGCGCCTACATGAGTAACGTGGCCAC
CTACCAAGACGCGACTACGGCTTGGCTTTCTACCGATGGCGTTCTGTCTTGGGTCACGACGTCAGTCTACGAAAG
ATTTGCCGGCGGCGGCTACCTGAGCGGCGTGAAGCTGATCAGGGGCTACACCGAACCCAACAAGGCCAAGGACAA
GGAGGACAAAGGTCAGGGATCGTCGACCCATAGCCCCCTCGACGACTCGGATGAGCGCCAGCAGAGGACCTTGAA
GCGAAAGACGGCGCCCCACTCGAGTAGAGATTCTAGTAGCGACTCAAACCACAAGTCGGATGATTCGAACCAGCC
AGATATCCGGCAGCTGAAGCTGCAGCGACAGCTCTCGTCTCTGATGGAGAGTGAAGGCAACGACGGTGCCTCGAC
GGAAGAACAGATTCGAAAGCGCGATGAGCAAGAAATCCAGGACGACTACAACGCGCAGGCGGGCGAGGCCCAGGG
CCGCGAAATCGAGCATCTGGTCCTCGTCACCCACGGCATAGGACAGCGCCTCGGCCTTCGGTATGACGAGATCAA
ACCCGCGTCTTCTCGGATGACTTGCTGACCGGCTCTCGTCTAGGATGGAGAGCGTCAACTTCGTCCACGACGCCA
ACGTGCTGCGTAAGACGCTCAAGTCCGTCTACACGAACTCGGCCGACTTGAAAGCTCTCAACTCGGAGCTCCATG
CCGGGCCCGGAAACTGCCGGGTCCAGGTTCTTCCTGTGTGCTGGAGACATCTGATCGAATTCCCGCGGCAGCGCC
AGCGGAAAGGCGAGCATGACTTGGGAGACGTCGAAGGGGAAGAAGATGGATGTAAGTTGACGCCGGCGGCCGTGT
CGATGGGGACATGCTCACACGCATCTCAGATCCGTCCTTGGAGGACATCACGGTCGAAGGCGTGGCCTTTGCCCG
GTCGCTCATCTCGGACCTGGCCCTCGACGTCCTGCTGTACCAGAGCTCGTACCGCGACGAGATCTCGAAAGTCGT
GGTTGGCGAAACGAACCGCATAGTGAAGCTCTTTCGAGAGCGCAACCCCGATTTCAAGGGCCAGGTGCATCTCAT
GGGCCATTCGCTCGGCTCCGCCATCTTCTTCGACGTCCTGTGTCACCAAAGGGAACGGCAGGACGAGCACAGGCA
TACCCTGCGCATGTGGCCCCATCAAGGACGGCCGGCGAGCCGGGCCAAGGACGGCGAGCTGCAGTTTGATTTCGA
CGTGCACAACTACTTTTGCCTCGGGTCCCCGGTCGGACTGTTCCAGATGCTCAAGGGGCGGTACGGGAGCCCATG
CCCACTGCTCTTTCGCCCCCGTCTCTTGTCGGCCTGCTGACGCGCCTCAGGACCATCGCGGCCCGGCCTGCAGCG
GTCGGCCTGCCGCCGGAGAATGCGCTGCGCGCCGACGGGACGAAGGACCCGTTTCTGGCCTCGCAGACGGCGTCG
ACTGCCGAGCGCATCTCCCCCGTCGACGGACTGCCGGCTCGGGTGTCGTCGCCCAGGGTCAGACAGCTGTTCAAC
ATCTTCCACCCGTCGGACCCGGTGAGCTACCGGCTGGAGCCCCTGATATCGCCGGCCATGGCGACGCTCAAGCCG
CAGGCGCTGCCGTACACCAAGAAGGGCCTGTTCGGCAACGTGGCGCCGCAGGGCCTGACGGGCATCGGAGCCAAG
GTCGGGCAGAGCGTCAGCGGGCTGTGGTCGAGCCTGAGCGCGGGCATCGCGAGCAACCTGCTCAACCGCAGCCTC
GGGCTCTCCAACGAGGAGGTGACGCGGATGGCGGCCGGGGAGACGGCGGCGCGGCAGGCGGACGGGGCCGAGGCC
GAGGGGCGCAAGCAGCAGCTGGCCGACTCGGCGGCGGCGGGGCAGCACAACGCGACGCTCATCGACGACGAGCTC
GAGACGCTCTACTCGACCTTCCAGCGGAGCCGGACGGCGGGGCCGCGGGACGGAGAGGAGGAGGCGGCGGCGGCG
GCGACCAAGGCCGGCGACGAGAGCCGCCGGGCGCGCAAGCTGCGCGGCGAGGAGACCAAGGTGCGGGCGCTGAAC
CGCAACGGGCGCGTCGACTACAGCATCCAGGAGTAAGTCCCCACCCCCCCGTCGACGAGGCGGAGCGAGAAGGCT
GACGCGCGCCCGCGCCCAGGAGCGCCCTCGACTTCAACCCCATCAACACCATCGCGTCGCACATGGGCTACTGGG
CCGACGACGACGTCAACCACTTCATCCTGTCGCAGCTGCTGTCGAGCCGCGCGCGGGGCGGCACGCCGGGCCGAC
ACGGGCGAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail