Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3481
Gene name
LocationContig_191:6768..8066
Strand-
Gene length (bp)1298
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-28 26 292
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-10 253 396
PF00083 Sugar_tr Sugar (and other) transporter 1.6E-06 247 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 1 403 1.0E-60
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 6 395 5.0E-58
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 17 336 2.0E-18
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 63 385 4.0E-12
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 33 383 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 1 403 1.0E-60
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 6 395 5.0E-58
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 17 336 2.0E-18
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 63 385 4.0E-12
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 33 383 1.0E-11
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 32 385 2.0E-11
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 63 385 3.0E-11
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 63 398 5.0E-11
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 6 366 8.0E-11
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 6 366 2.0E-10
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 6 366 4.0E-10
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 6 366 8.0E-10
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 6 163 9.0E-10
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 25 186 2.0E-09
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 62 384 5.0E-09
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 6 176 6.0E-09
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 6 399 7.0E-09
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 6 269 2.0E-08
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 6 269 4.0E-08
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 25 174 4.0E-08
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 6 269 5.0E-08
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 33 381 1.0E-07
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 33 381 1.0E-07
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 33 399 2.0E-07
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 25 204 2.0E-07
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 33 162 7.0E-07
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 25 163 3.0E-06
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 21 163 3.0E-06
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 21 163 5.0E-06
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 25 187 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 60 77 17
3 87 109 22
4 121 143 22
5 147 169 22
6 198 220 22
7 240 262 22
8 269 291 22
9 306 328 22
10 340 362 22
11 372 394 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3481
MTAGLGLVNSTGIFEAYVSNTVLSSSSSNAVGWIFGIYVFVSYFCGVQIGPIFDARGPRQLMLLGSVCLLAGTFA
VSQCTEYYQFLLAFSILSGIGNSLLFTPAMGAIAHWFDKRRGTASGFAFTGSGFGGVLFPIIFQALLPRIGWAWT
MRIIGFVLLFLCIVSVALCRSRLPPIKGSATSWRDMLPSVRIFRDGTGAMALTTIGVLFVELAYFVPVTYVPSYY
LVRQGLTGESAVSEAAAFAYQLLAILNGASCFGRYLAGYVADEIGRFNTMIIGSLLAMISVLALWFADALADERP
SLALLIAFVVVFGFASGANITLTPICIGQLCTTQEYGRYYAAAFTVCSFGCLLSIPIAGNLLTATGIGGRRGYWA
VILFAGISYVVAFSCFLWVRVRIKGWNWATIW*
Coding >Hirsu2|3481
ATGACGGCAGGCCTCGGTCTCGTCAACTCGACGGGCATCTTCGAGGCTTACGTCTCGAACACGGTTCTGTCCTCA
AGCTCCTCAAACGCTGTTGGCTGGATCTTTGGCATCTACGTCTTCGTATCATACTTCTGCGGGGTGCAGATCGGG
CCGATCTTCGACGCCCGGGGCCCCAGGCAGCTGATGTTGTTGGGCAGTGTATGTCTGCTCGCTGGGACCTTTGCC
GTGAGCCAGTGCACAGAGTATTATCAGTTCCTGTTGGCATTTTCTATATTGAGCGGAATAGGCAACTCGCTCTTG
TTTACGCCCGCCATGGGCGCCATTGCTCACTGGTTCGACAAGCGACGCGGTACTGCGAGTGGTTTTGCCTTTACG
GGCAGCGGCTTTGGCGGCGTCCTCTTCCCCATAATCTTCCAAGCACTTCTTCCCCGTATTGGCTGGGCTTGGACA
ATGCGCATTATCGGCTTTGTCTTGCTCTTTCTATGCATTGTCAGCGTGGCTCTCTGCAGGAGTCGCTTGCCGCCC
ATCAAGGGATCGGCCACCTCCTGGCGCGACATGCTCCCCAGCGTGCGCATATTCCGAGACGGCACTGGTGCCATG
GCCCTGACCACAATCGGGGTGCTGTTTGTCGAGTTGGCATATTTCGTCCCCGTCACGTACGTGCCGAGCTACTAC
CTCGTGCGCCAAGGGCTCACGGGCGAGAGTGCGGTGAGCGAAGCGGCGGCATTCGCCTATCAACTCCTCGCAATT
CTTAATGGCGCATCGTGCTTTGGCCGATACTTGGCCGGGTACGTAGCTGATGAGATCGGCCGCTTTAATACCATG
ATCATAGGCTCCTTGCTCGCAATGATCTCGGTCTTGGCGCTATGGTTCGCGGACGCCTTGGCAGACGAGCGGCCC
AGTCTGGCGCTGCTCATTGCATTCGTCGTCGTGTTCGGATTCGCGAGTGGCGCCAACATTACGCTGACGCCCATC
TGCATTGGCCAGCTCTGCACCACACAGGAGTACGGGCGATATTACGCCGCCGCCTTCACCGTCTGCAGCTTCGGC
TGCCTTCTTAGCATCCCCATTGCTGGCAATCTCCTAACGGCAACCGGAATCGGTGGCAGGAGAGGTTACTGGGCC
GTTATTCTCTTTGCCGGCATAAGCTATGTCGTCGCATTTTCCTGCTTCCTCTGGGTACGTGTGCGGATAAAGGGA
TGGAATTGGGCAACAATCTGGTGA
Transcript >Hirsu2|3481
ATGACGGCAGGCCTCGGTCTCGTCAACTCGACGGGCATCTTCGAGGCTTACGTCTCGAACACGGTTCTGTCCTCA
AGCTCCTCAAACGCTGTTGGCTGGATCTTTGGCATCTACGTCTTCGTATCATACTTCTGCGGGGTGCAGATCGGG
CCGATCTTCGACGCCCGGGGCCCCAGGCAGCTGATGTTGTTGGGCAGTGTATGTCTGCTCGCTGGGACCTTTGCC
GTGAGCCAGTGCACAGAGTATTATCAGTTCCTGTTGGCATTTTCTATATTGAGCGGAATAGGCAACTCGCTCTTG
TTTACGCCCGCCATGGGCGCCATTGCTCACTGGTTCGACAAGCGACGCGGTACTGCGAGTGGTTTTGCCTTTACG
GGCAGCGGCTTTGGCGGCGTCCTCTTCCCCATAATCTTCCAAGCACTTCTTCCCCGTATTGGCTGGGCTTGGACA
ATGCGCATTATCGGCTTTGTCTTGCTCTTTCTATGCATTGTCAGCGTGGCTCTCTGCAGGAGTCGCTTGCCGCCC
ATCAAGGGATCGGCCACCTCCTGGCGCGACATGCTCCCCAGCGTGCGCATATTCCGAGACGGCACTGGTGCCATG
GCCCTGACCACAATCGGGGTGCTGTTTGTCGAGTTGGCATATTTCGTCCCCGTCACGTACGTGCCGAGCTACTAC
CTCGTGCGCCAAGGGCTCACGGGCGAGAGTGCGGTGAGCGAAGCGGCGGCATTCGCCTATCAACTCCTCGCAATT
CTTAATGGCGCATCGTGCTTTGGCCGATACTTGGCCGGGTACGTAGCTGATGAGATCGGCCGCTTTAATACCATG
ATCATAGGCTCCTTGCTCGCAATGATCTCGGTCTTGGCGCTATGGTTCGCGGACGCCTTGGCAGACGAGCGGCCC
AGTCTGGCGCTGCTCATTGCATTCGTCGTCGTGTTCGGATTCGCGAGTGGCGCCAACATTACGCTGACGCCCATC
TGCATTGGCCAGCTCTGCACCACACAGGAGTACGGGCGATATTACGCCGCCGCCTTCACCGTCTGCAGCTTCGGC
TGCCTTCTTAGCATCCCCATTGCTGGCAATCTCCTAACGGCAACCGGAATCGGTGGCAGGAGAGGTTACTGGGCC
GTTATTCTCTTTGCCGGCATAAGCTATGTCGTCGCATTTTCCTGCTTCCTCTGGGTACGTGTGCGGATAAAGGGA
TGGAATTGGGCAACAATCTGGTGA
Gene >Hirsu2|3481
ATGACGGCAGGCCTCGGTCTCGTCAACTCGACGGGCATCTTCGAGGCTTACGTCTCGAACACGGTTCTGTCCTCA
AGCTCCTCAAACGCTGTTGGCTGGATCTTTGGCATCTACGTCTTCGTATCATACTTCTGCGGGGTGCAGATCGGG
CCGATCTTCGACGCCCGGGGCCCCAGGCAGCTGATGTTGTTGGGCAGTGTATGTCTGCTCGCTGGGACCTTTGCC
GTGAGCCAGTGCACAGGTATGCAGCTGGGATGTTCGCCTCGGATGCTCAGACTCGAGAGAGAGCTGCTGACATCG
TAAAAACACGAAAAGAGTATTATCAGTTCCTGTTGGCATTTTCTATATTGAGCGGAATAGGCAACTCGCTCTTGT
TTACGCCCGCCATGGGCGCCATTGCTCACTGGTTCGACAAGCGACGCGGTACTGCGAGTGGTTTTGCCTTTACGG
GCAGCGGCTTTGGCGGCGTCCTCTTCCCCATAATCTTCCAAGCACTTCTTCCCCGTATTGGCTGGGCTTGGACAA
TGCGCATTATCGGCTTTGTCTTGCTCTTTCTATGCATTGTCAGCGTGGCTCTCTGCAGGAGTCGCTTGCCGCCCA
TCAAGGGATCGGCCACCTCCTGGCGCGACATGCTCCCCAGCGTGCGCATATTCCGAGACGGCACTGGTGCCATGG
CCCTGACCACAATCGGGGTGCTGTTTGTCGAGTTGGCATATTTCGTCCCCGTCACGTACGTGCCGAGCTACTACC
TCGTGCGCCAAGGGCTCACGGGCGAGAGTGCGGTGAGCGAAGCGGCGGCATTCGCCTATCAACTCCTCGCAATTC
TTAATGGCGCATCGTGCTTTGGCCGATACTTGGCCGGGTACGTAGCTGATGAGATCGGCCGCTTTAATACCATGA
TCATAGGCTCCTTGCTCGCAATGATCTCGGTCTTGGCGCTATGGTTCGCGGACGCCTTGGCAGACGAGCGGCCCA
GTCTGGCGCTGCTCATTGCATTCGTCGTCGTGTTCGGATTCGCGAGTGGCGCCAACATTACGCTGACGCCCATCT
GCATTGGCCAGCTCTGCACCACACAGGAGTACGGGCGATATTACGCCGCCGCCTTCACCGTCTGCAGCTTCGGCT
GCCTTCTTAGCATCCCCATTGCTGGCAATCTCCTAACGGCAACCGGAATCGGTGGCAGGAGAGGTTACTGGGCCG
TTATTCTCTTTGCCGGCATAAGCTATGTCGTCGCATTTTCCTGCTTCCTCTGGGTACGTGTGCGGATAAAGGGAT
GGAATTGGGCAACAATCTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail