Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3473
Gene name
LocationContig_1906:3104..3854
Strand+
Gene length (bp)750
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain 9.3E-09 35 214
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 4.3E-09 128 213
PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain 1.3E-08 152 234

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9KL03|ATDA_VIBCH Spermidine N(1)-acetyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=speG PE=1 SV=1 132 231 3.0E-10
sp|O31995|YOKL_BACSU SPBc2 prophage-derived uncharacterized N-acetyltransferase YokL OS=Bacillus subtilis (strain 168) GN=yokL PE=3 SV=1 145 243 6.0E-08
sp|P96579|YDAF_BACSU Putative ribosomal N-acetyltransferase YdaF OS=Bacillus subtilis (strain 168) GN=ydaF PE=1 SV=1 154 243 3.0E-07
sp|P94482|YNAD_BACSU Uncharacterized N-acetyltransferase YnaD OS=Bacillus subtilis (strain 168) GN=ynaD PE=3 SV=1 115 242 1.0E-06
sp|O34569|YOAA_BACSU Uncharacterized N-acetyltransferase YoaA OS=Bacillus subtilis (strain 168) GN=yoaA PE=3 SV=2 142 231 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3473
MPAVPDRPASSVLGEAAQAFRSARLQYIRLDEADEDIAAFVPTLAKDPVVQTLAAPDMLRPKDKKEVDLYLEQYA
KAFLGVAICLLPTEEQQRQEEEDQQQKQQARDMTSGSGSGSGSGSGSGSGPVSAAKAKVTVVGIISLGWGGIPAS
TAHNRTASIGISLAGEHQNRGYGREAINWILDWGFRHGGLHTINLCAYSCNERAMHLYQDIGFRPEGRKREVLWF
NRRWYDEVWFGMTEHEWERLRGIA*
Coding >Hirsu2|3473
ATGCCGGCGGTACCCGACCGGCCGGCCAGCTCGGTGCTGGGCGAGGCGGCGCAGGCCTTCCGCTCGGCGCGGCTG
CAGTACATCCGGCTCGACGAGGCGGACGAGGACATCGCCGCCTTTGTGCCGACGCTGGCCAAGGACCCGGTGGTG
CAGACGCTGGCGGCGCCCGACATGCTGCGGCCCAAGGACAAGAAGGAGGTGGACCTGTACCTCGAGCAGTACGCC
AAGGCCTTCCTCGGCGTCGCCATCTGCCTCTTGCCGACGGAGGAGCAGCAGCGGCAGGAGGAGGAGGATCAGCAG
CAGAAGCAGCAGGCAAGGGACATGACGTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGC
CCGGTCTCGGCGGCCAAGGCCAAGGTGACGGTCGTCGGCATCATCTCGCTCGGCTGGGGCGGGATCCCGGCGTCG
ACGGCGCACAACCGGACGGCCAGCATCGGCATCTCGCTGGCGGGCGAGCACCAGAACCGCGGCTACGGGCGCGAG
GCCATCAACTGGATCCTCGACTGGGGCTTCCGCCACGGCGGCCTGCACACCATCAACCTGTGCGCCTACTCGTGC
AACGAGCGGGCCATGCACCTGTACCAGGACATCGGCTTCCGGCCCGAGGGCAGGAAGCGCGAGGTGCTGTGGTTC
AACCGCCGCTGGTACGACGAGGTCTGGTTCGGCATGACGGAGCACGAGTGGGAGAGGCTGCGAGGCATCGCCTGA
Transcript >Hirsu2|3473
ATGCCGGCGGTACCCGACCGGCCGGCCAGCTCGGTGCTGGGCGAGGCGGCGCAGGCCTTCCGCTCGGCGCGGCTG
CAGTACATCCGGCTCGACGAGGCGGACGAGGACATCGCCGCCTTTGTGCCGACGCTGGCCAAGGACCCGGTGGTG
CAGACGCTGGCGGCGCCCGACATGCTGCGGCCCAAGGACAAGAAGGAGGTGGACCTGTACCTCGAGCAGTACGCC
AAGGCCTTCCTCGGCGTCGCCATCTGCCTCTTGCCGACGGAGGAGCAGCAGCGGCAGGAGGAGGAGGATCAGCAG
CAGAAGCAGCAGGCAAGGGACATGACGTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGC
CCGGTCTCGGCGGCCAAGGCCAAGGTGACGGTCGTCGGCATCATCTCGCTCGGCTGGGGCGGGATCCCGGCGTCG
ACGGCGCACAACCGGACGGCCAGCATCGGCATCTCGCTGGCGGGCGAGCACCAGAACCGCGGCTACGGGCGCGAG
GCCATCAACTGGATCCTCGACTGGGGCTTCCGCCACGGCGGCCTGCACACCATCAACCTGTGCGCCTACTCGTGC
AACGAGCGGGCCATGCACCTGTACCAGGACATCGGCTTCCGGCCCGAGGGCAGGAAGCGCGAGGTGCTGTGGTTC
AACCGCCGCTGGTACGACGAGGTCTGGTTCGGCATGACGGAGCACGAGTGGGAGAGGCTGCGAGGCATCGCCTGA
Gene >Hirsu2|3473
ATGCCGGCGGTACCCGACCGGCCGGCCAGCTCGGTGCTGGGCGAGGCGGCGCAGGCCTTCCGCTCGGCGCGGCTG
CAGTACATCCGGCTCGACGAGGCGGACGAGGACATCGCCGCCTTTGTGCCGACGCTGGCCAAGGACCCGGTGGTG
CAGACGCTGGCGGCGCCCGACATGCTGCGGCCCAAGGACAAGAAGGAGGTGGACCTGTACCTCGAGCAGTACGCC
AAGGCCTTCCTCGGCGTCGCCATCTGCCTCTTGCCGACGGAGGAGCAGCAGCGGCAGGAGGAGGAGGATCAGCAG
CAGAAGCAGCAGGCAAGGGACATGACGTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGCTCCGGC
CCGGTCTCGGCGGCCAAGGCCAAGGTGACGGTCGTCGGCATCATCTCGCTCGGCTGGGGCGGGATCCCGGCGTCG
ACGGCGCACAACCGGACGGCCAGCATCGGCATCTCGCTGGCGGGCGAGCACCAGAACCGCGGCTACGGGCGCGAG
GCCATCAACTGGATCCTCGACTGGGGCTTCCGCCACGGCGGCCTGCACACCATCAACCTGTGCGCCTACTCGTGC
AACGAGCGGGCCATGCACCTGTACCAGGACATCGGCTTCCGGCCCGAGGGCAGGAAGCGCGAGGTGCTGTGGTTC
AACCGCCGCTGGTACGACGAGGTCTGGTTCGGCATGACGGAGCACGAGTGGGAGAGGCTGCGAGGCATCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail