Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3459
Gene name
LocationContig_1900:1166..1740
Strand+
Gene length (bp)574
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.6E-19 4 139
PF07714 Pkinase_Tyr Protein tyrosine kinase 4.5E-11 7 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 1 139 2.0E-78
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 1 139 2.0E-74
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 1 139 3.0E-52
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 1 139 7.0E-51
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 1 139 8.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 1 139 2.0E-78
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 1 139 2.0E-74
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 1 139 3.0E-52
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 1 139 7.0E-51
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 1 139 8.0E-41
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 1 139 4.0E-40
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 1 139 2.0E-38
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 1 139 2.0E-38
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 1 139 3.0E-38
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 1 139 3.0E-38
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 1 97 3.0E-38
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 1 139 6.0E-38
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 1 139 6.0E-38
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 1 139 1.0E-37
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 1 139 2.0E-37
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 1 139 2.0E-37
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 1 139 2.0E-37
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 1 139 3.0E-37
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 1 97 4.0E-37
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 1 97 6.0E-37
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 1 139 7.0E-37
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 1 139 8.0E-37
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 1 139 2.0E-36
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 1 97 2.0E-36
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 1 139 2.0E-36
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 1 139 2.0E-36
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 1 139 2.0E-36
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 1 139 2.0E-36
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 1 139 3.0E-36
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 1 139 4.0E-36
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 1 139 6.0E-36
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 1 139 7.0E-36
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 1 139 8.0E-36
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 1 139 1.0E-35
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 1 139 1.0E-35
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 1 139 3.0E-35
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 1 139 5.0E-35
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 1 139 6.0E-35
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 5 97 1.0E-34
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 1 139 2.0E-34
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 1 139 4.0E-34
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 1 98 4.0E-34
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 1 139 5.0E-34
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 4 139 5.0E-33
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 1 97 6.0E-33
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 1 139 8.0E-33
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 1 139 9.0E-33
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 4 139 9.0E-33
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 1 139 4.0E-32
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 1 139 5.0E-32
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 1 139 8.0E-32
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 4 139 1.0E-31
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 1 139 2.0E-31
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 1 139 2.0E-31
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 1 139 5.0E-31
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 1 139 5.0E-31
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 1 139 5.0E-31
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 1 96 6.0E-31
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 1 139 7.0E-31
sp|Q8SR86|CDK1_ENCCU Cyclin-dependent kinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC28 PE=3 SV=1 2 103 8.0E-31
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 1 139 1.0E-30
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 1 117 2.0E-30
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1 1 139 3.0E-30
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 4 139 5.0E-30
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 1 139 6.0E-30
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 1 139 6.0E-30
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 1 117 7.0E-30
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 1 139 8.0E-30
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 1 139 5.0E-29
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 4 139 6.0E-29
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 1 139 2.0E-28
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 1 139 2.0E-28
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 4 139 2.0E-28
sp|P19026|CDC21_PEA Cell division control protein 2 homolog 1 (Fragment) OS=Pisum sativum GN=CDC2 PE=2 SV=1 17 97 2.0E-28
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 1 139 3.0E-28
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 1 139 4.0E-28
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 3 139 4.0E-28
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 1 86 4.0E-28
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 4 139 8.0E-28
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2 1 139 1.0E-27
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 14 97 1.0E-27
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 4 139 2.0E-27
sp|Q38775|CDC2D_ANTMA Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1 1 139 3.0E-27
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 4 139 8.0E-27
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 4 139 4.0E-26
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 1 94 2.0E-24
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 1 94 2.0E-24
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 1 94 2.0E-24
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 1 95 4.0E-23
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 1 139 2.0E-22
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 1 139 2.0E-22
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 1 94 3.0E-22
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 2 129 3.0E-22
sp|O61847|CDK2_CAEEL Cyclin-dependent kinase 2 OS=Caenorhabditis elegans GN=cdk-2 PE=1 SV=2 4 139 3.0E-22
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 1 94 4.0E-22
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 2 97 4.0E-22
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 1 93 5.0E-22
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 2 131 7.0E-22
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 2 131 7.0E-22
sp|Q01917|CDC2H_CRIFA Cell division control protein 2 homolog OS=Crithidia fasciculata GN=CRK PE=3 SV=1 4 97 8.0E-22
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 2 97 9.0E-22
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 1 94 1.0E-21
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 2 121 1.0E-21
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 1 94 1.0E-21
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 1 94 1.0E-21
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 2 131 1.0E-21
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 2 131 1.0E-21
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 2 131 2.0E-21
sp|Q55GS4|CDK10_DICDI Probable cyclin-dependent kinase 10 OS=Dictyostelium discoideum GN=cdk10 PE=2 SV=1 3 96 2.0E-21
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 2 131 2.0E-21
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 2 121 4.0E-21
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 4 89 1.0E-19
sp|P43290|CDC2_PETHY Cell division control protein 2 homolog (Fragment) OS=Petunia hybrida GN=CDC2 PE=2 SV=1 43 139 2.0E-19
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 1 137 3.0E-19
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 1 137 3.0E-19
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 2 90 3.0E-19
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 4 89 4.0E-19
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 1 100 4.0E-19
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 2 90 4.0E-19
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 4 89 8.0E-19
sp|Q2TBL8|CDK10_BOVIN Cyclin-dependent kinase 10 OS=Bos taurus GN=CDK10 PE=2 SV=1 1 99 9.0E-19
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 1 90 9.0E-19
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 2 90 1.0E-18
sp|Q4KM47|CDK10_RAT Cyclin-dependent kinase 10 OS=Rattus norvegicus GN=Cdk10 PE=2 SV=1 1 98 1.0E-18
sp|Q96Q40|CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens GN=CDK15 PE=1 SV=2 3 97 1.0E-18
sp|Q15131|CDK10_HUMAN Cyclin-dependent kinase 10 OS=Homo sapiens GN=CDK10 PE=1 SV=1 1 99 2.0E-18
sp|Q3UMM4|CDK10_MOUSE Cyclin-dependent kinase 10 OS=Mus musculus GN=Cdk10 PE=1 SV=1 1 99 2.0E-18
sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 4 95 2.0E-18
sp|Q3V3A1|CDK15_MOUSE Cyclin-dependent kinase 15 OS=Mus musculus GN=Cdk15 PE=2 SV=2 3 97 3.0E-18
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 10 139 3.0E-18
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 10 139 4.0E-18
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 10 139 4.0E-18
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 1 101 4.0E-18
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 3 97 6.0E-18
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 4 89 6.0E-18
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 10 139 9.0E-18
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 10 139 1.0E-17
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 10 139 1.0E-17
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 10 139 1.0E-17
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 10 139 1.0E-17
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 4 89 2.0E-17
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1 4 89 2.0E-17
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 10 139 3.0E-17
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 3 136 3.0E-17
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 1 101 4.0E-17
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 1 139 5.0E-17
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 10 93 6.0E-17
sp|P46892|CD11B_RAT Cyclin-dependent kinase 11B OS=Rattus norvegicus GN=Cdk11b PE=1 SV=1 1 96 1.0E-16
sp|Q9TVL3|CDK9_CAEEL Probable cyclin-dependent kinase 9 OS=Caenorhabditis elegans GN=cdk-9 PE=3 SV=2 1 89 1.0E-16
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 1 97 1.0E-16
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 1 97 1.0E-16
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 1 137 2.0E-16
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 1 137 2.0E-16
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 1 139 2.0E-16
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 1 139 2.0E-16
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 2 90 2.0E-16
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 1 139 3.0E-16
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 2 89 3.0E-16
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 1 97 3.0E-16
sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1 1 96 5.0E-16
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 1 139 6.0E-16
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 1 139 6.0E-16
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 2 90 6.0E-16
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 2 90 6.0E-16
sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=4 1 96 1.0E-15
sp|P21127|CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens GN=CDK11B PE=1 SV=3 1 96 1.0E-15
sp|P24788|CD11B_MOUSE Cyclin-dependent kinase 11B OS=Mus musculus GN=Cdk11b PE=1 SV=2 1 96 2.0E-15
sp|Q6ZAG3|CDKC3_ORYSJ Cyclin-dependent kinase C-3 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=3 SV=2 1 94 2.0E-15
sp|Q54RB2|CDK11_DICDI Cyclin-dependent kinase 11 OS=Dictyostelium discoideum GN=cdk11 PE=3 SV=1 4 96 2.0E-15
sp|Q96VK3|BUR1_EMENI Serine/threonine-protein kinase bur1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ptkA PE=2 SV=1 1 137 2.0E-15
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 4 89 3.0E-15
sp|Q96WV9|CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdk9 PE=1 SV=1 1 94 3.0E-15
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 1 97 3.0E-15
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 5 90 4.0E-15
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 4 89 9.0E-15
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 4 89 9.0E-15
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 4 89 1.0E-14
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 4 89 1.0E-14
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 2 139 1.0E-14
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 4 97 2.0E-14
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 4 97 2.0E-14
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 1 89 2.0E-14
sp|Q95YH0|CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum GN=cdk8 PE=2 SV=1 2 89 3.0E-14
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 2 136 3.0E-14
sp|F4I114|Y1960_ARATH Probable serine/threonine-protein kinase At1g09600 OS=Arabidopsis thaliana GN=At1g09600 PE=3 SV=1 2 139 4.0E-14
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 1 94 4.0E-14
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 1 121 7.0E-14
sp|Q4WTN5|BUR1_ASPFU Serine/threonine-protein kinase bur1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bur1 PE=3 SV=1 1 137 1.0E-13
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 1 89 1.0E-13
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 1 97 1.0E-13
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 1 139 2.0E-13
sp|Q5EDC3|CDK20_MACMU Cyclin-dependent kinase 20 OS=Macaca mulatta GN=CDK20 PE=2 SV=1 1 89 2.0E-13
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 4 137 4.0E-13
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 4 89 5.0E-13
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 1 91 6.0E-13
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 1 139 7.0E-13
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 1 97 7.0E-13
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 1 91 7.0E-13
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 4 89 7.0E-13
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 1 97 7.0E-13
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 4 89 7.0E-13
sp|Q4I5U9|BUR1_GIBZE Serine/threonine-protein kinase BUR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BUR1 PE=3 SV=2 1 137 8.0E-13
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 4 97 9.0E-13
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 1 139 1.0E-12
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 9 89 1.0E-12
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 4 97 1.0E-12
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 4 97 1.0E-12
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 4 97 1.0E-12
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 1 116 2.0E-12
sp|Q8SQW2|CTK1_ENCCU Probable CTD kinase subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CTK1 PE=3 SV=1 4 95 3.0E-12
sp|Q871M9|BUR1_NEUCR Serine/threonine-protein kinase bur1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-1 PE=3 SV=2 1 137 4.0E-12
sp|G5EFV5|CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans GN=cdk-7 PE=1 SV=1 4 90 4.0E-12
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 4 90 7.0E-12
sp|Q8SR90|Y8H9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1790 PE=3 SV=1 1 89 8.0E-12
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 4 90 1.0E-11
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 1 86 2.0E-11
sp|Q6BV06|BUR1_DEBHA Serine/threonine-protein kinase BUR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BUR1 PE=3 SV=1 1 74 2.0E-11
sp|Q6CRA9|BUR1_KLULA Serine/threonine-protein kinase BUR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR1 PE=3 SV=1 1 72 3.0E-11
sp|A4QXX4|SSN3_MAGO7 Serine/threonine-protein kinase SSN3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SSN3 PE=3 SV=2 1 89 4.0E-11
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 1 95 5.0E-11
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 1 86 5.0E-11
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 1 86 5.0E-11
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 1 86 6.0E-11
sp|Q6P3N6|CDK8_XENTR Cyclin-dependent kinase 8 OS=Xenopus tropicalis GN=cdk8 PE=2 SV=1 9 89 6.0E-11
sp|Q66KH9|CDK8_XENLA Cyclin-dependent kinase 8 OS=Xenopus laevis GN=cdk8 PE=2 SV=1 9 89 6.0E-11
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 2 94 7.0E-11
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 2 94 8.0E-11
sp|Q17IE8|CDK8_AEDAE Cyclin-dependent kinase 8 OS=Aedes aegypti GN=Cdk8 PE=3 SV=2 9 89 1.0E-10
sp|Q8JH47|CDK8_DANRE Cyclin-dependent kinase 8 OS=Danio rerio GN=cdk8 PE=2 SV=1 9 89 1.0E-10
sp|Q1EBK0|SSN3_COCIM Serine/threonine-protein kinase SSN3 OS=Coccidioides immitis (strain RS) GN=SSN3 PE=3 SV=3 2 89 2.0E-10
sp|Q9XTR1|CDK4_CAEEL Cyclin-dependent kinase 4 homolog OS=Caenorhabditis elegans GN=cdk-4 PE=1 SV=2 7 97 3.0E-10
sp|Q12126|CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crk1 PE=1 SV=1 3 90 5.0E-10
sp|Q6FQ83|BUR1_CANGA Serine/threonine-protein kinase BUR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BUR1 PE=3 SV=1 3 72 6.0E-10
sp|Q75D46|BUR1_ASHGO Serine/threonine-protein kinase BUR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BUR1 PE=3 SV=1 3 72 7.0E-10
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 2 94 9.0E-10
sp|Q9BWU1|CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens GN=CDK19 PE=1 SV=1 9 136 2.0E-09
sp|Q8BWD8|CDK19_MOUSE Cyclin-dependent kinase 19 OS=Mus musculus GN=Cdk19 PE=2 SV=1 9 136 2.0E-09
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 2 89 2.0E-09
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 4 95 4.0E-09
sp|P23293|BUR1_YEAST Serine/threonine-protein kinase BUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGV1 PE=1 SV=1 3 89 4.0E-09
sp|O13958|SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srb10 PE=1 SV=2 2 108 6.0E-09
sp|Q9Y7W4|BUR1_CANAL Serine/threonine-protein kinase BUR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRK1 PE=3 SV=2 1 71 8.0E-09
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 4 95 1.0E-08
sp|Q0CQK1|SSN3_ASPTN Serine/threonine-protein kinase ssn3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ssn3 PE=3 SV=1 2 89 1.0E-08
sp|A3LUB9|SSN3_PICST Serine/threonine-protein kinase SSN3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SSN3 PE=3 SV=2 1 89 1.0E-08
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 4 94 1.0E-08
sp|P28567|CDC22_PEA Cell division control protein 2 homolog 2 (Fragment) OS=Pisum sativum PE=2 SV=1 32 89 1.0E-08
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 4 95 1.0E-08
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 4 94 2.0E-08
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 4 95 2.0E-08
sp|Q8R3L8|CDK8_MOUSE Cyclin-dependent kinase 8 OS=Mus musculus GN=Cdk8 PE=2 SV=3 9 89 2.0E-08
sp|Q2GYV9|SSN3_CHAGB Serine/threonine-protein kinase SSN3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SSN3 PE=3 SV=1 2 89 2.0E-08
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 4 95 2.0E-08
sp|O80345|CDKF1_ARATH Cyclin-dependent kinase F-1 OS=Arabidopsis thaliana GN=CDKF-1 PE=1 SV=1 4 139 3.0E-08
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 1 93 4.0E-08
sp|Q0E459|MPK13_ORYSJ Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. japonica GN=MPK13 PE=2 SV=1 4 95 4.0E-08
sp|A2X0M1|MPK13_ORYSI Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. indica GN=MPK13 PE=2 SV=2 4 95 4.0E-08
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 4 95 5.0E-08
sp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 9 OS=Arabidopsis thaliana GN=MPK9 PE=2 SV=2 4 95 5.0E-08
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 1 116 5.0E-08
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 1 116 5.0E-08
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 1 136 5.0E-08
sp|P0C661|CDK8_CAEBR Cyclin-dependent kinase 8 OS=Caenorhabditis briggsae GN=cdk-8 PE=3 SV=2 4 89 6.0E-08
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 10 139 6.0E-08
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 4 85 6.0E-08
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 4 85 6.0E-08
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 4 85 6.0E-08
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 4 85 7.0E-08
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 2 137 7.0E-08
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 1 94 7.0E-08
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 2 84 8.0E-08
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 2 84 8.0E-08
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 4 94 9.0E-08
sp|Q4FCZ5|SSN3_GIBMO Serine/threonine-protein kinase SSN3 OS=Gibberella moniliformis GN=SSN3 PE=1 SV=1 2 89 9.0E-08
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 2 85 1.0E-07
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 2 85 1.0E-07
sp|Q556J6|Y4007_DICDI Putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007 OS=Dictyostelium discoideum GN=DDB_G0272797 PE=3 SV=1 1 139 1.0E-07
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 1 136 1.0E-07
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 1 116 1.0E-07
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 4 100 1.0E-07
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 2 85 1.0E-07
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 3 137 1.0E-07
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 1 136 1.0E-07
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 4 95 1.0E-07
sp|Q9LUC3|MPK19_ARATH Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2 4 95 1.0E-07
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 1 136 1.0E-07
sp|P49336|CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens GN=CDK8 PE=1 SV=1 9 89 1.0E-07
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 4 98 1.0E-07
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 9 117 1.0E-07
sp|Q9VT57|CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster GN=Cdk8 PE=1 SV=2 3 89 1.0E-07
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 4 95 1.0E-07
sp|P90866|CDK8_CAEEL Cyclin-dependent kinase 8 OS=Caenorhabditis elegans GN=cdk-8 PE=3 SV=4 4 89 2.0E-07
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 4 85 2.0E-07
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 4 85 2.0E-07
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 4 85 2.0E-07
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 4 95 2.0E-07
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 4 85 2.0E-07
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 4 85 2.0E-07
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 4 85 2.0E-07
sp|Q9LM33|MPK8_ARATH Mitogen-activated protein kinase 8 OS=Arabidopsis thaliana GN=MPK8 PE=1 SV=2 4 95 2.0E-07
sp|Q9C5C0|MPK18_ARATH Mitogen-activated protein kinase 18 OS=Arabidopsis thaliana GN=MPK18 PE=1 SV=4 4 95 2.0E-07
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 2 137 2.0E-07
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 1 86 2.0E-07
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 4 95 3.0E-07
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 2 85 3.0E-07
sp|Q6CCB0|SSN3_YARLI Serine/threonine-protein kinase SSN3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSN3 PE=3 SV=1 1 89 3.0E-07
sp|Q4WYR6|SSN3_ASPFU Serine/threonine-protein kinase ssn3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssn3 PE=3 SV=2 2 89 3.0E-07
sp|A1D624|SSN3_NEOFI Serine/threonine-protein kinase ssn3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ssn3 PE=3 SV=1 2 89 3.0E-07
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 4 137 4.0E-07
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 4 137 4.0E-07
sp|Q9Z1B7|MK13_MOUSE Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=1 SV=2 10 137 4.0E-07
sp|Q0TWJ7|SSN3_PHANO Serine/threonine-protein kinase SSN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SSN3 PE=3 SV=1 2 89 4.0E-07
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 4 137 4.0E-07
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 4 137 5.0E-07
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 10 84 5.0E-07
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 4 137 5.0E-07
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 4 95 5.0E-07
sp|Q5BAE1|SSN3_EMENI Serine/threonine-protein kinase ssn3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ssn3 PE=3 SV=2 2 89 6.0E-07
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 8 95 6.0E-07
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 1 136 6.0E-07
sp|A2QU77|SSN3_ASPNC Serine/threonine-protein kinase ssn3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ssn3 PE=3 SV=2 2 89 6.0E-07
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 1 109 7.0E-07
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 4 98 7.0E-07
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 2 65 7.0E-07
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 4 136 8.0E-07
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 2 84 8.0E-07
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 4 137 9.0E-07
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 1 109 9.0E-07
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 4 137 9.0E-07
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 4 137 9.0E-07
sp|Q84M93|MPK17_ARATH Mitogen-activated protein kinase 17 OS=Arabidopsis thaliana GN=MPK17 PE=2 SV=1 4 94 9.0E-07
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 2 84 9.0E-07
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 4 137 1.0E-06
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 2 84 1.0E-06
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 4 137 1.0E-06
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 2 100 1.0E-06
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 4 136 1.0E-06
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 4 137 1.0E-06
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 4 137 2.0E-06
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 4 137 2.0E-06
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 4 137 2.0E-06
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 4 137 2.0E-06
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 4 95 2.0E-06
sp|A1CL96|SSN3_ASPCL Serine/threonine-protein kinase ssn3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ssn3 PE=3 SV=2 2 89 2.0E-06
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 4 137 2.0E-06
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 4 100 2.0E-06
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 4 98 2.0E-06
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 10 84 2.0E-06
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 10 84 2.0E-06
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 4 137 2.0E-06
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 4 93 2.0E-06
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 4 137 2.0E-06
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 4 137 2.0E-06
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 4 137 2.0E-06
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 2 137 2.0E-06
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 10 84 3.0E-06
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 2 84 3.0E-06
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 4 137 3.0E-06
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 4 97 3.0E-06
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 2 137 4.0E-06
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 1 109 4.0E-06
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 2 137 4.0E-06
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 1 89 4.0E-06
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 2 137 4.0E-06
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 2 137 4.0E-06
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 2 137 4.0E-06
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 2 65 4.0E-06
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 2 137 4.0E-06
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 2 137 4.0E-06
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 8 86 4.0E-06
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 4 95 4.0E-06
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 1 137 4.0E-06
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 2 137 4.0E-06
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 4 137 4.0E-06
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 4 137 5.0E-06
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 2 86 5.0E-06
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 1 137 5.0E-06
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 4 100 5.0E-06
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 1 137 5.0E-06
sp|Q9WTY9|MK13_RAT Mitogen-activated protein kinase 13 OS=Rattus norvegicus GN=Mapk13 PE=1 SV=1 10 137 5.0E-06
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 4 137 5.0E-06
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 1 137 5.0E-06
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 4 137 5.0E-06
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 2 100 5.0E-06
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 10 137 5.0E-06
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 2 84 5.0E-06
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 4 100 6.0E-06
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 4 137 6.0E-06
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 4 100 6.0E-06
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 4 100 6.0E-06
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 4 137 6.0E-06
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 2 137 6.0E-06
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 4 100 6.0E-06
sp|Q2UC58|SSN3_ASPOR Serine/threonine-protein kinase SSN3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ssn3 PE=3 SV=2 2 89 6.0E-06
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 1 84 7.0E-06
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 1 84 7.0E-06
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 9 137 8.0E-06
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 4 84 8.0E-06
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 4 100 8.0E-06
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 2 100 8.0E-06
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 4 84 8.0E-06
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 2 137 8.0E-06
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 4 137 8.0E-06
sp|O42099|MK08B_CYPCA Mitogen-activated protein kinase 8B OS=Cyprinus carpio GN=mapk8b PE=2 SV=1 1 89 8.0E-06
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 4 137 9.0E-06
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 2 100 9.0E-06
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 4 137 1.0E-05
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 4 97 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3459
MENYQKLEKVGEGTYGVVYKARDLANGGRIVALKKIRLEAEDEGVPSTAIREISLLKEMKDPNIVRLLNIVHADG
HKLYLVFEFLDLDLKKYMEALPVSDGGRGKALPEGSSLQIMQLGLSETVVQKFMMQLCEGIKTC*
Coding >Hirsu2|3459
ATGGAGAACTACCAGAAGCTGGAAAAGGTTGGCGAAGGCACGTATGGCGTCGTCTACAAGGCGCGAGACCTGGCC
AATGGCGGGCGCATCGTGGCGCTCAAGAAGATCCGGCTCGAGGCCGAAGACGAGGGCGTGCCGAGCACGGCGATC
CGCGAGATCTCGCTGCTCAAGGAGATGAAGGACCCCAACATCGTGCGGCTGCTCAACATCGTCCACGCCGACGGC
CACAAGCTGTACCTCGTCTTCGAATTCCTCGACCTCGACCTCAAGAAGTACATGGAGGCGCTGCCCGTCAGCGAC
GGCGGGCGCGGCAAGGCCCTGCCCGAGGGCTCGTCGCTGCAGATCATGCAGCTGGGGCTGAGCGAGACGGTGGTG
CAAAAGTTCATGATGCAGCTGTGCGAGGGCATCAAAACCTGCTGA
Transcript >Hirsu2|3459
ATGGAGAACTACCAGAAGCTGGAAAAGGTTGGCGAAGGCACGTATGGCGTCGTCTACAAGGCGCGAGACCTGGCC
AATGGCGGGCGCATCGTGGCGCTCAAGAAGATCCGGCTCGAGGCCGAAGACGAGGGCGTGCCGAGCACGGCGATC
CGCGAGATCTCGCTGCTCAAGGAGATGAAGGACCCCAACATCGTGCGGCTGCTCAACATCGTCCACGCCGACGGC
CACAAGCTGTACCTCGTCTTCGAATTCCTCGACCTCGACCTCAAGAAGTACATGGAGGCGCTGCCCGTCAGCGAC
GGCGGGCGCGGCAAGGCCCTGCCCGAGGGCTCGTCGCTGCAGATCATGCAGCTGGGGCTGAGCGAGACGGTGGTG
CAAAAGTTCATGATGCAGCTGTGCGAGGGCATCAAAACCTGCTGA
Gene >Hirsu2|3459
ATGGAGAACTACCAGAAGCTGGAAAAGGTTGGCGAAGGTGAGTCGCTTCCGACCGACCGTACCCTGCGGGCGAGC
TGGCCCTTGGACCTCCGAACAAGGCTGGGACTGACGGGGCCCCGGGCGATGGCGGCGTCTCTCCCTGCAGGCACG
TATGGCGTCGTCTACAAGGCGCGAGACCTGGCCAATGGCGGGCGCATCGTGGCGCTCAAGAAGATCCGGCTCGAG
GCCGAAGACGAGGGCGTGCCGAGCACGGCGATCCGCGAGATCTCGCTGCTCAAGGAGATGAAGGACCCCAACATC
GTGCGGCTGCTCAACATCGTCCACGCCGACGGCCACAAGCTGTACCTCGTCTTCGAATTCCTCGACCTCGACCTC
AAGAAGTACATGGAGGCGCTGCCCGTCAGCGACGGCGGGCGCGGCAAGGCCCTGCCCGAGGGCTCGTCGCTGCAG
ATCATGCAGCTGGGGCTGAGCGAGACGGTGGTGCAAAAGTTCATGATGCAGCTGTGCGAGGGCATCAAGTACTGC
CACTCGCACCGCGTCCTGCACCGCGACCTGAAGCCGCAGAACCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail