Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3457
Gene name
LocationContig_190:29041..30256
Strand-
Gene length (bp)1215
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 2.4E-53 26 266
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 2.4E-06 144 209
PF04140 ICMT Isoprenylcysteine carboxyl methyltransferase (ICMT) family 5.2E-05 171 209

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004671 protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0006481 C-terminal protein methylation Yes
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0043414 macromolecule methylation No
GO:0010340 carboxyl-O-methyltransferase activity No
GO:0008171 O-methyltransferase activity No
GO:0019538 protein metabolic process No
GO:0008213 protein alkylation No
GO:0044425 membrane part No
GO:0016491 oxidoreductase activity No
GO:0018410 C-terminal protein amino acid modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0043687 post-translational protein modification No
GO:0031224 intrinsic component of membrane No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032259 methylation No
GO:0006479 protein methylation No
GO:0071704 organic substance metabolic process No
GO:0008276 protein methyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008168 methyltransferase activity No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0051998 protein carboxyl O-methyltransferase activity No
GO:0003880 protein C-terminal carboxyl O-methyltransferase activity No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 41 58 17
3 68 90 22
4 103 125 22
5 140 162 22
6 191 213 22
7 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3457
MGTAHVLDDYYLAITAIVTVAYQLFFFAIAFTFKFDKLTDLAGGSNFAVLAILTLALSGHHHARQVVASLFLIVW
AVRLSGFLFFRILRTGSDDRFDDKRDKFLPFLGFWLFQMLWVWTVSLPVTVLNSPNVTRYPQHAFGTGRDVAGIV
LFALGFLMESVSDVQKYRFRNAHDGHAVCNRGLFALSRHPNYFGEIIIQFSIYMIAVSSAADGYVGGQAYKALYA
TILGPFFLTILLMFVSGLPLSERPKAKSRFDKGNNWDEYKRWLDRTSILIPFPPQLYARMPVLLKRTLFLEFPMY
VFDPAKHSDASHPPSRDARGARSASASGRSTRQSGEERLV*
Coding >Hirsu2|3457
ATGGGGACCGCGCACGTGCTCGACGACTATTACCTGGCCATCACGGCCATCGTCACCGTCGCCTACCAGCTCTTC
TTCTTCGCCATCGCCTTCACCTTCAAGTTCGACAAACTCACCGACCTCGCCGGCGGCTCCAACTTTGCCGTGCTG
GCCATCCTCACGCTCGCCCTGTCCGGCCACCACCACGCGCGCCAGGTGGTGGCCTCGCTCTTCCTCATCGTCTGG
GCCGTCCGCCTGTCCGGCTTCCTCTTCTTCCGCATCCTGCGCACCGGGTCCGACGACCGGTTCGACGACAAGCGC
GACAAGTTCCTGCCCTTCCTCGGCTTCTGGCTCTTCCAGATGCTGTGGGTTTGGACCGTCTCCCTGCCCGTCACC
GTCCTCAACTCGCCCAACGTGACGCGCTACCCGCAGCACGCCTTCGGCACCGGCAGGGACGTCGCCGGCATCGTC
CTCTTCGCCCTCGGCTTCCTCATGGAGAGCGTGAGTGACGTGCAAAAGTACCGCTTCCGCAACGCCCACGACGGC
CACGCCGTCTGCAACCGTGGCCTGTTCGCCCTGTCGCGACACCCCAACTACTTTGGTGAAATCATCATCCAGTTC
TCCATCTACATGATCGCCGTCTCCTCCGCCGCCGACGGCTACGTCGGTGGTCAGGCCTACAAGGCCCTCTACGCC
ACCATCCTCGGCCCCTTCTTCCTCACCATCCTCCTCATGTTCGTCTCGGGCCTGCCGCTGTCGGAACGGCCCAAG
GCCAAGTCGCGCTTCGACAAGGGCAACAACTGGGACGAGTACAAGCGCTGGCTCGACCGCACCAGCATCCTCATC
CCCTTCCCGCCCCAGCTCTACGCCCGGATGCCCGTCCTCCTCAAGCGCACCCTCTTCCTCGAGTTCCCCATGTAC
GTCTTCGACCCGGCCAAGCACTCGGACGCGTCGCACCCGCCCTCCCGCGACGCACGGGGGGCCCGTTCCGCGTCG
GCGAGCGGCCGCAGCACCAGGCAGAGCGGCGAGGAGAGGTTGGTCTGA
Transcript >Hirsu2|3457
ATGGGGACCGCGCACGTGCTCGACGACTATTACCTGGCCATCACGGCCATCGTCACCGTCGCCTACCAGCTCTTC
TTCTTCGCCATCGCCTTCACCTTCAAGTTCGACAAACTCACCGACCTCGCCGGCGGCTCCAACTTTGCCGTGCTG
GCCATCCTCACGCTCGCCCTGTCCGGCCACCACCACGCGCGCCAGGTGGTGGCCTCGCTCTTCCTCATCGTCTGG
GCCGTCCGCCTGTCCGGCTTCCTCTTCTTCCGCATCCTGCGCACCGGGTCCGACGACCGGTTCGACGACAAGCGC
GACAAGTTCCTGCCCTTCCTCGGCTTCTGGCTCTTCCAGATGCTGTGGGTTTGGACCGTCTCCCTGCCCGTCACC
GTCCTCAACTCGCCCAACGTGACGCGCTACCCGCAGCACGCCTTCGGCACCGGCAGGGACGTCGCCGGCATCGTC
CTCTTCGCCCTCGGCTTCCTCATGGAGAGCGTGAGTGACGTGCAAAAGTACCGCTTCCGCAACGCCCACGACGGC
CACGCCGTCTGCAACCGTGGCCTGTTCGCCCTGTCGCGACACCCCAACTACTTTGGTGAAATCATCATCCAGTTC
TCCATCTACATGATCGCCGTCTCCTCCGCCGCCGACGGCTACGTCGGTGGTCAGGCCTACAAGGCCCTCTACGCC
ACCATCCTCGGCCCCTTCTTCCTCACCATCCTCCTCATGTTCGTCTCGGGCCTGCCGCTGTCGGAACGGCCCAAG
GCCAAGTCGCGCTTCGACAAGGGCAACAACTGGGACGAGTACAAGCGCTGGCTCGACCGCACCAGCATCCTCATC
CCCTTCCCGCCCCAGCTCTACGCCCGGATGCCCGTCCTCCTCAAGCGCACCCTCTTCCTCGAGTTCCCCATGTAC
GTCTTCGACCCGGCCAAGCACTCGGACGCGTCGCACCCGCCCTCCCGCGACGCACGGGGGGCCCGTTCCGCGTCG
GCGAGCGGCCGCAGCACCAGGCAGAGCGGCGAGGAGAGGTTGGTCTGA
Gene >Hirsu2|3457
ATGGGGACCGCGCACGTGCTCGACGACTATTACCTGGCCATCACGGCCATCGTCACCGTCGCCTACCAGCTCTTC
TTCTTCGCCATCGCCTTCACCTTCAAGTTCGACAAACTCACCGGTAGGCTTCCCTCCCCTCCGTTCCAGCGGGAG
AGGCGGATCTGACGGCGGCTCCGACGGCCAGACCTCGCCGGCGGCTCCAACTTTGCCGTGCTGGCCATCCTCACG
CTCGCCCTGTCCGGCCACCACCACGCGCGCCAGGTGGTGGCCTCGCTCTTCCTCATCGTCTGGGCCGTCCGCCTG
TCCGGCTTCCTCTTCTTCCGCATCCTGCGCACCGGGTCCGACGACCGGTTCGACGACAAGCGCGACAAGTTCCTG
CCCTTCCTCGGCTTCTGGCTCTTCCAGATGCTGTGGGTTTGGACCGTCTCCCTGCCCGTCACCGTCCTCAACTCG
CCCAACGTGACGCGCTACCCGCAGCACGCCTTCGGCACCGGCAGGGACGTCGCCGGCATCGTCCTCTTCGCCCTC
GGCTTCCTCATGGAGAGCGTGAGTGACGTGCAAAAGTACCGCTTCCGCAACGCCCACGACGGCCACGCCGTCTGC
AACCGTGGCCTGTTCGCCCTGTCGCGACACCCCAACTACTTTGGTGAAATCATCATCCAGTTCTGTACGCGCCGC
CCCTCTCTCCTCGCCCCGTGATTCGACTCTCTCTCTCCCTCTCTCTCCGTCGTTGTTGTTTGTCGTAGTCGGCCC
CCGGTTCGCTGACCAGGCCGGATGCGCGCCGCCGCCACGACAGCCATCTACATGATCGCCGTCTCCTCCGCCGCC
GACGGCTACGTCGGTGGTCAGGCCTACAAGGCCCTCTACGCCACCATCCTCGGCCCCTTCTTCCTCACCATCCTC
CTCATGTTCGTCTCGGGCCTGCCGCTGTCGGAACGGCCCAAGGCCAAGTCGCGCTTCGACAAGGGCAACAACTGG
GACGAGTACAAGCGCTGGCTCGACCGCACCAGCATCCTCATCCCCTTCCCGCCCCAGCTCTACGCCCGGATGCCC
GTCCTCCTCAAGCGCACCCTCTTCCTCGAGTTCCCCATGTACGTCTTCGACCCGGCCAAGCACTCGGACGCGTCG
CACCCGCCCTCCCGCGACGCACGGGGGGCCCGTTCCGCGTCGGCGAGCGGCCGCAGCACCAGGCAGAGCGGCGAG
GAGAGGTTGGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail