Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3455
Gene name
LocationContig_190:24366..26718
Strand+
Gene length (bp)2352
Transcript length (bp)2352
Coding sequence length (bp)2352
Protein length (aa) 784

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain 1.2E-81 107 299
PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain 2.7E-33 5 106
PF02769 AIRS_C AIR synthase related protein, C-terminal domain 8.0E-33 609 769
PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain 4.0E-25 337 426
PF00586 AIRS AIR synthase related protein, N-terminal domain 3.6E-14 494 594

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99148|PUR2_YARLI Bifunctional purine biosynthetic protein ADE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADE1 PE=3 SV=1 4 782 0.0E+00
sp|P20772|PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade1 PE=3 SV=1 1 782 0.0E+00
sp|P07244|PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE5,7 PE=1 SV=1 4 778 0.0E+00
sp|Q54GJ2|PUR2_DICDI Bifunctional purine biosynthetic protein purD OS=Dictyostelium discoideum GN=purD PE=1 SV=1 5 765 0.0E+00
sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 1 779 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99148|PUR2_YARLI Bifunctional purine biosynthetic protein ADE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADE1 PE=3 SV=1 4 782 0.0E+00
sp|P20772|PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade1 PE=3 SV=1 1 782 0.0E+00
sp|P07244|PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE5,7 PE=1 SV=1 4 778 0.0E+00
sp|Q54GJ2|PUR2_DICDI Bifunctional purine biosynthetic protein purD OS=Dictyostelium discoideum GN=purD PE=1 SV=1 5 765 0.0E+00
sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 1 779 0.0E+00
sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens GN=GART PE=1 SV=1 5 779 0.0E+00
sp|Q59A32|PUR2_BOVIN Trifunctional purine biosynthetic protein adenosine-3 OS=Bos taurus GN=GART PE=2 SV=1 5 779 0.0E+00
sp|Q64737|PUR2_MOUSE Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus GN=Gart PE=1 SV=3 5 779 0.0E+00
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 1 780 0.0E+00
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 5 738 1.0E-178
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 6 740 2.0E-174
sp|Q8YGB9|PUR5_BRUME Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purM PE=3 SV=1 436 769 3.0E-126
sp|C0RI52|PUR5_BRUMB Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purM PE=3 SV=1 436 769 3.0E-126
sp|A6X235|PUR5_OCHA4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=purM PE=3 SV=1 427 769 7.0E-126
sp|Q9KV81|PUR2_VIBCH Phosphoribosylamine--glycine ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purD PE=3 SV=1 4 432 1.0E-125
sp|Q8G1K5|PUR5_BRUSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella suis biovar 1 (strain 1330) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|B0CL36|PUR5_BRUSI Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|A5VPP4|PUR5_BRUO2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|A9MA84|PUR5_BRUC2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|Q57E30|PUR5_BRUAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|Q2YN59|PUR5_BRUA2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus (strain 2308) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|B2S4W8|PUR5_BRUA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Brucella abortus (strain S19) GN=purM PE=3 SV=1 436 769 4.0E-125
sp|Q87KS8|PUR2_VIBPA Phosphoribosylamine--glycine ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purD PE=3 SV=1 4 428 7.0E-125
sp|Q7MGT4|PUR2_VIBVY Phosphoribosylamine--glycine ligase OS=Vibrio vulnificus (strain YJ016) GN=purD PE=3 SV=2 4 428 8.0E-125
sp|Q8DD07|PUR2_VIBVU Phosphoribosylamine--glycine ligase OS=Vibrio vulnificus (strain CMCP6) GN=purD PE=3 SV=1 4 428 2.0E-124
sp|Q984K6|PUR5_RHILO Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium loti (strain MAFF303099) GN=purM PE=3 SV=1 436 767 3.0E-123
sp|Q8UG98|PUR5_AGRFC Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purM PE=3 SV=2 436 777 5.0E-122
sp|Q1MIW9|PUR5_RHIL3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purM PE=3 SV=1 436 777 6.0E-122
sp|B3PV93|PUR5_RHIE6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium etli (strain CIAT 652) GN=purM PE=3 SV=1 436 777 3.0E-121
sp|Q8KBV8|PUR2_CHLTE Phosphoribosylamine--glycine ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purD PE=3 SV=1 4 428 4.0E-121
sp|B9JCV0|PUR5_AGRRK Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=purM PE=3 SV=1 436 777 6.0E-121
sp|Q2KA45|PUR5_RHIEC Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purM PE=3 SV=1 436 777 7.0E-121
sp|B9JUY3|PUR5_AGRVS Phosphoribosylformylglycinamidine cyclo-ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=purM PE=3 SV=1 434 777 4.0E-120
sp|A7HYF2|PUR5_PARL1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purM PE=3 SV=1 433 765 5.0E-120
sp|B5ZX12|PUR5_RHILW Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=purM PE=3 SV=1 436 777 5.0E-119
sp|A9IVF6|PUR5_BART1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=purM PE=3 SV=1 436 777 5.0E-119
sp|P57829|PUR2_PASMU Phosphoribosylamine--glycine ligase OS=Pasteurella multocida (strain Pm70) GN=purD PE=3 SV=1 4 427 1.0E-118
sp|Q2RSC8|PUR5_RHORT Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purM PE=3 SV=2 436 771 3.0E-118
sp|Q9KF52|PUR2_BACHD Phosphoribosylamine--glycine ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purD PE=3 SV=1 4 437 3.0E-118
sp|Q8ZAR2|PUR2_YERPE Phosphoribosylamine--glycine ligase OS=Yersinia pestis GN=purD PE=1 SV=1 4 428 4.0E-118
sp|Q8XXC4|PUR2_RALSO Phosphoribosylamine--glycine ligase OS=Ralstonia solanacearum (strain GMI1000) GN=purD PE=3 SV=1 4 429 4.0E-118
sp|Q6FZK1|PUR5_BARQU Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella quintana (strain Toulouse) GN=purM PE=3 SV=1 436 768 5.0E-118
sp|Q11GW6|PUR5_CHESB Phosphoribosylformylglycinamidine cyclo-ligase OS=Chelativorans sp. (strain BNC1) GN=purM PE=3 SV=1 436 767 1.0E-117
sp|Q92RL0|PUR2_RHIME Phosphoribosylamine--glycine ligase OS=Rhizobium meliloti (strain 1021) GN=purD PE=3 SV=1 4 432 1.0E-117
sp|Q8UHN3|PUR2_AGRFC Phosphoribosylamine--glycine ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purD PE=3 SV=2 4 432 1.0E-117
sp|Q8YRD8|PUR2_NOSS1 Phosphoribosylamine--glycine ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purD PE=3 SV=1 4 426 6.0E-117
sp|Q9HUV8|PUR2_PSEAE Phosphoribosylamine--glycine ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purD PE=3 SV=1 4 428 6.0E-117
sp|Q6G5R9|PUR5_BARHE Phosphoribosylformylglycinamidine cyclo-ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purM PE=3 SV=1 432 769 2.0E-116
sp|Q46482|PUR2_ALLVD Phosphoribosylamine--glycine ligase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purD PE=3 SV=2 4 428 6.0E-116
sp|Q87VR8|PUR2_PSESM Phosphoribosylamine--glycine ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purD PE=3 SV=1 4 428 9.0E-116
sp|Q8RC54|PUR2_CALS4 Phosphoribosylamine--glycine ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purD PE=3 SV=1 4 424 9.0E-116
sp|P12039|PUR2_BACSU Phosphoribosylamine--glycine ligase OS=Bacillus subtilis (strain 168) GN=purD PE=1 SV=1 4 429 2.0E-115
sp|Q92QW2|PUR5_RHIME Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium meliloti (strain 1021) GN=purM PE=3 SV=1 436 777 2.0E-115
sp|O66949|PUR2_AQUAE Phosphoribosylamine--glycine ligase OS=Aquifex aeolicus (strain VF5) GN=purD PE=1 SV=1 4 432 2.0E-115
sp|Q8REV7|PUR2_FUSNN Phosphoribosylamine--glycine ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=purD PE=3 SV=1 4 423 2.0E-115
sp|C3M9F7|PUR5_RHISN Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium sp. (strain NGR234) GN=purM PE=3 SV=1 436 777 4.0E-115
sp|Q8X612|PUR2_ECO57 Phosphoribosylamine--glycine ligase OS=Escherichia coli O157:H7 GN=purD PE=3 SV=1 4 429 1.0E-114
sp|B8IP71|PUR5_METNO Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=purM PE=3 SV=1 436 769 2.0E-114
sp|Q8PQ21|PUR2_XANAC Phosphoribosylamine--glycine ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purD PE=3 SV=1 4 428 2.0E-114
sp|P74232|PUR2_SYNY3 Phosphoribosylamine--glycine ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purD PE=3 SV=1 4 428 3.0E-114
sp|Q8FB69|PUR2_ECOL6 Phosphoribosylamine--glycine ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purD PE=3 SV=1 4 429 3.0E-114
sp|Q986A5|PUR2_RHILO Phosphoribosylamine--glycine ligase OS=Rhizobium loti (strain MAFF303099) GN=purD PE=3 SV=1 4 427 3.0E-114
sp|P15640|PUR2_ECOLI Phosphoribosylamine--glycine ligase OS=Escherichia coli (strain K12) GN=purD PE=1 SV=2 4 429 5.0E-114
sp|Q8PD48|PUR2_XANCP Phosphoribosylamine--glycine ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purD PE=3 SV=1 4 428 6.0E-114
sp|Q8Z334|PUR2_SALTI Phosphoribosylamine--glycine ligase OS=Salmonella typhi GN=purD PE=3 SV=1 4 429 8.0E-114
sp|P26977|PUR2_SALTY Phosphoribosylamine--glycine ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purD PE=3 SV=1 4 429 8.0E-114
sp|A8LNB8|PUR5_DINSH Phosphoribosylformylglycinamidine cyclo-ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=purM PE=3 SV=1 436 764 9.0E-114
sp|Q88DK2|PUR2_PSEPK Phosphoribosylamine--glycine ligase OS=Pseudomonas putida (strain KT2440) GN=purD PE=3 SV=1 4 428 1.0E-113
sp|B0UKC4|PUR5_METS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacterium sp. (strain 4-46) GN=purM PE=3 SV=1 436 769 1.0E-113
sp|Q7UPZ8|PUR2_RHOBA Phosphoribosylamine--glycine ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purD PE=3 SV=2 1 428 3.0E-113
sp|Q9JWU6|PUR2_NEIMA Phosphoribosylamine--glycine ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purD PE=3 SV=1 4 429 3.0E-112
sp|Q28RA9|PUR5_JANSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Jannaschia sp. (strain CCS1) GN=purM PE=3 SV=1 433 764 5.0E-112
sp|Q8G2B1|PUR2_BRUSU Phosphoribosylamine--glycine ligase OS=Brucella suis biovar 1 (strain 1330) GN=purD PE=3 SV=1 4 427 6.0E-112
sp|Q97J90|PUR2_CLOAB Phosphoribosylamine--glycine ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purD PE=3 SV=1 4 423 8.0E-112
sp|Q9JXA3|PUR2_NEIMB Phosphoribosylamine--glycine ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=purD PE=3 SV=1 4 429 9.0E-112
sp|B8EJY5|PUR5_METSB Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=purM PE=3 SV=1 436 766 1.0E-111
sp|A6U7L8|PUR5_SINMW Phosphoribosylformylglycinamidine cyclo-ligase OS=Sinorhizobium medicae (strain WSM419) GN=purM PE=3 SV=1 436 777 3.0E-111
sp|P43845|PUR2_HAEIN Phosphoribosylamine--glycine ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purD PE=3 SV=1 4 431 3.0E-111
sp|Q8YFK1|PUR2_BRUME Phosphoribosylamine--glycine ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purD PE=3 SV=1 4 427 3.0E-111
sp|B2IJR2|PUR5_BEII9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=purM PE=3 SV=1 436 772 7.0E-111
sp|Q5LRF9|PUR5_RUEPO Phosphoribosylformylglycinamidine cyclo-ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purM PE=3 SV=1 436 764 2.0E-110
sp|Q6N5C8|PUR5_RHOPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=purM PE=3 SV=1 434 771 2.0E-110
sp|Q1GGK7|PUR5_RUEST Phosphoribosylformylglycinamidine cyclo-ligase OS=Ruegeria sp. (strain TM1040) GN=purM PE=3 SV=1 434 770 6.0E-110
sp|Q9FDL5|PUR2_ZYMMO Phosphoribosylamine--glycine ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=purD PE=3 SV=2 4 423 2.0E-109
sp|Q3SS83|PUR5_NITWN Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=purM PE=3 SV=1 435 765 4.0E-109
sp|Q9PC09|PUR2_XYLFA Phosphoribosylamine--glycine ligase OS=Xylella fastidiosa (strain 9a5c) GN=purD PE=3 SV=1 4 428 9.0E-109
sp|Q1G9G0|PUR5_LACDA Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purM PE=3 SV=1 438 771 9.0E-109
sp|Q049L9|PUR5_LACDB Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purM PE=3 SV=1 438 771 2.0E-108
sp|Q87D59|PUR2_XYLFT Phosphoribosylamine--glycine ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purD PE=3 SV=1 4 428 2.0E-108
sp|Q1QLI2|PUR5_NITHX Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=purM PE=3 SV=1 436 765 4.0E-108
sp|B9KMR6|PUR5_RHOSK Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purM PE=3 SV=1 434 768 6.0E-108
sp|Q215Q6|PUR5_RHOPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=purM PE=3 SV=1 436 765 7.0E-108
sp|Q167K4|PUR5_ROSDO Phosphoribosylformylglycinamidine cyclo-ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=purM PE=3 SV=1 430 768 9.0E-108
sp|A3PHH4|PUR5_RHOS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=purM PE=3 SV=1 434 768 1.0E-107
sp|Q2SKT3|PUR5_HAHCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Hahella chejuensis (strain KCTC 2396) GN=purM PE=3 SV=1 435 772 4.0E-107
sp|P52420|PUR2_ARATH Phosphoribosylamine--glycine ligase, chloroplastic OS=Arabidopsis thaliana GN=PUR2 PE=2 SV=2 4 430 7.0E-107
sp|Q9XAT2|PUR5_RHILE Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhizobium leguminosarum GN=purM PE=3 SV=1 436 777 8.0E-107
sp|Q3J517|PUR5_RHOS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purM PE=3 SV=1 434 768 9.0E-107
sp|Q1GSA2|PUR5_SPHAL Phosphoribosylformylglycinamidine cyclo-ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=purM PE=3 SV=1 429 783 8.0E-106
sp|Q9ABD2|PUR2_CAUCR Phosphoribosylamine--glycine ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purD PE=3 SV=1 1 430 5.0E-105
sp|Q7NS12|PUR5_CHRVO Phosphoribosylformylglycinamidine cyclo-ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purM PE=3 SV=1 435 771 1.0E-104
sp|A4WX36|PUR5_RHOS5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purM PE=3 SV=1 434 766 1.0E-104
sp|Q9JZ80|PUR5_NEIMB Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=purM PE=3 SV=1 435 768 1.0E-104
sp|Q9JUA2|PUR5_NEIMA Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purM PE=3 SV=1 435 768 2.0E-104
sp|A9LZD2|PUR5_NEIM0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=purM PE=3 SV=1 435 768 2.0E-104
sp|Q9A1Y7|PUR2_STRP1 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M1 GN=purD PE=3 SV=1 4 430 2.0E-104
sp|Q8P308|PUR2_STRP8 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purD PE=3 SV=1 4 430 3.0E-104
sp|A1KU60|PUR5_NEIMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purM PE=3 SV=1 435 768 4.0E-104
sp|P0DD59|PUR2_STRPQ Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purD PE=3 SV=1 4 430 7.0E-104
sp|P0DD58|PUR2_STRP3 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purD PE=3 SV=1 4 430 7.0E-104
sp|Q5XEF0|PUR2_STRP6 Phosphoribosylamine--glycine ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purD PE=3 SV=2 4 430 7.0E-104
sp|Q2G9X9|PUR5_NOVAD Phosphoribosylformylglycinamidine cyclo-ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=purM PE=3 SV=1 433 783 1.0E-103
sp|B3E3K3|PUR5_GEOLS Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purM PE=3 SV=1 437 776 1.0E-103
sp|Q2KX26|PUR5_BORA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella avium (strain 197N) GN=purM PE=3 SV=1 436 770 4.0E-103
sp|Q92AP4|PUR2_LISIN Phosphoribosylamine--glycine ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purD PE=3 SV=1 4 427 5.0E-103
sp|Q5F973|PUR5_NEIG1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purM PE=3 SV=1 435 768 6.0E-103
sp|B8DTT6|PUR5_BIFA0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=purM PE=3 SV=1 433 767 8.0E-103
sp|Q126R8|PUR5_POLSJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=purM PE=3 SV=1 436 770 1.0E-102
sp|A7FG37|PUR5_YERP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|A4TMP3|PUR5_YERPP Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis (strain Pestoides F) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|Q1CK40|PUR5_YERPN Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|A9QZW5|PUR5_YERPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|Q8ZCX8|PUR5_YERPE Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis GN=purM PE=3 SV=1 435 777 2.0E-102
sp|Q1C5P2|PUR5_YERPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|B1JSF4|PUR5_YERPY Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|Q668E5|PUR5_YERPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|B2K9K0|PUR5_YERPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purM PE=3 SV=1 435 777 2.0E-102
sp|C6DBR0|PUR5_PECCP Phosphoribosylformylglycinamidine cyclo-ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purM PE=3 SV=1 435 770 3.0E-102
sp|B5EFU7|PUR5_GEOBB Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purM PE=3 SV=1 436 775 9.0E-102
sp|Q7N3F7|PUR5_PHOLL Phosphoribosylformylglycinamidine cyclo-ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=purM PE=3 SV=1 435 777 1.0E-101
sp|Q6D7S1|PUR5_PECAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purM PE=3 SV=1 435 770 1.0E-101
sp|Q8DRM0|PUR2_STRR6 Phosphoribosylamine--glycine ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purD PE=3 SV=1 4 429 2.0E-101
sp|Q71YQ4|PUR2_LISMF Phosphoribosylamine--glycine ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purD PE=3 SV=1 4 427 2.0E-101
sp|A1JKZ7|PUR5_YERE8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purM PE=3 SV=1 435 777 2.0E-101
sp|Q21MC3|PUR5_SACD2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=purM PE=3 SV=2 435 768 3.0E-101
sp|B7LKE3|PUR5_ESCF3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=purM PE=3 SV=1 435 764 4.0E-101
sp|Q87MH0|PUR5_VIBPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purM PE=3 SV=1 435 771 5.0E-101
sp|C6E6M9|PUR5_GEOSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter sp. (strain M21) GN=purM PE=3 SV=1 436 775 8.0E-101
sp|C5D4I2|PUR5_GEOSW Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus sp. (strain WCH70) GN=purM PE=3 SV=1 435 762 8.0E-101
sp|Q7MIK1|PUR5_VIBVY Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio vulnificus (strain YJ016) GN=purM PE=3 SV=1 435 771 1.0E-100
sp|Q8DBC2|PUR5_VIBVU Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio vulnificus (strain CMCP6) GN=purM PE=3 SV=1 435 771 1.0E-100
sp|B7VIN4|PUR5_VIBTL Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio tasmaniensis (strain LGP32) GN=purM PE=3 SV=1 435 777 1.0E-100
sp|Q97T98|PUR2_STRPN Phosphoribosylamine--glycine ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purD PE=3 SV=1 4 429 2.0E-100
sp|B5XNQ0|PUR5_KLEP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Klebsiella pneumoniae (strain 342) GN=purM PE=3 SV=1 435 771 2.0E-100
sp|A6TCB3|PUR5_KLEP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=purM PE=3 SV=1 435 771 2.0E-100
sp|Q1WU57|PUR5_LACS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus salivarius (strain UCC118) GN=purM PE=3 SV=1 438 777 3.0E-100
sp|Q2N8X9|PUR5_ERYLH Phosphoribosylformylglycinamidine cyclo-ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=purM PE=3 SV=1 437 777 1.0E-99
sp|Q8D245|PUR2_WIGBR Phosphoribosylamine--glycine ligase OS=Wigglesworthia glossinidia brevipalpis GN=purD PE=3 SV=1 4 426 1.0E-99
sp|B4EY89|PUR5_PROMH Phosphoribosylformylglycinamidine cyclo-ligase OS=Proteus mirabilis (strain HI4320) GN=purM PE=3 SV=1 435 777 1.0E-99
sp|C0PYQ6|PUR5_SALPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi C (strain RKS4594) GN=purM PE=3 SV=1 435 771 1.0E-99
sp|Q57LL0|PUR5_SALCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella choleraesuis (strain SC-B67) GN=purM PE=3 SV=3 435 771 1.0E-99
sp|Q9ZF44|PUR2_LACLA Phosphoribosylamine--glycine ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purD PE=3 SV=2 4 427 1.0E-99
sp|Q9KF55|PUR5_BACHD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purM PE=3 SV=1 438 752 2.0E-99
sp|Q4FR86|PUR5_PSYA2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purM PE=3 SV=1 435 768 2.0E-99
sp|P74883|PUR5_SALTY Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purM PE=3 SV=3 435 771 2.0E-99
sp|B4TR76|PUR5_SALSV Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=purM PE=3 SV=1 435 771 2.0E-99
sp|B5BB05|PUR5_SALPK Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=purM PE=3 SV=1 435 771 2.0E-99
sp|Q5PNJ8|PUR5_SALPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purM PE=3 SV=3 435 771 2.0E-99
sp|B4TD75|PUR5_SALHS Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella heidelberg (strain SL476) GN=purM PE=3 SV=1 435 771 2.0E-99
sp|B5FQJ2|PUR5_SALDC Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella dublin (strain CT_02021853) GN=purM PE=3 SV=1 435 771 2.0E-99
sp|A1TZ73|PUR5_MARHV Phosphoribosylformylglycinamidine cyclo-ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=purM PE=3 SV=1 435 777 2.0E-99
sp|A7MY25|PUR5_VIBCB Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=purM PE=3 SV=1 435 777 2.0E-99
sp|C3LPN0|PUR5_VIBCM Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purM PE=3 SV=1 435 764 2.0E-99
sp|Q9KPY6|PUR5_VIBCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purM PE=1 SV=1 435 764 2.0E-99
sp|A5F643|PUR5_VIBC3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=purM PE=3 SV=1 435 764 2.0E-99
sp|A4WD72|PUR5_ENT38 Phosphoribosylformylglycinamidine cyclo-ligase OS=Enterobacter sp. (strain 638) GN=purM PE=3 SV=1 435 762 3.0E-99
sp|A5G3H3|PUR5_GEOUR Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter uraniireducens (strain Rf4) GN=purM PE=3 SV=1 431 775 3.0E-99
sp|Q8Y6C6|PUR2_LISMO Phosphoribosylamine--glycine ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purD PE=3 SV=1 4 427 4.0E-99
sp|Q5HTL1|PUR2_CAMJR Phosphoribosylamine--glycine ligase OS=Campylobacter jejuni (strain RM1221) GN=purD PE=3 SV=1 4 429 6.0E-99
sp|Q9PN47|PUR2_CAMJE Phosphoribosylamine--glycine ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purD PE=1 SV=1 4 429 6.0E-99
sp|A7ML12|PUR5_CROS8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purM PE=3 SV=1 435 764 6.0E-99
sp|Q12MF0|PUR5_SHEDO Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=purM PE=3 SV=1 433 768 8.0E-99
sp|Q1H4W1|PUR5_METFK Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purM PE=3 SV=1 435 776 9.0E-99
sp|Q1Q9M0|PUR5_PSYCK Phosphoribosylformylglycinamidine cyclo-ligase OS=Psychrobacter cryohalolentis (strain K5) GN=purM PE=3 SV=1 435 768 1.0E-98
sp|Q2NS68|PUR5_SODGM Phosphoribosylformylglycinamidine cyclo-ligase OS=Sodalis glossinidius (strain morsitans) GN=purM PE=3 SV=1 435 777 1.0E-98
sp|B9M1P4|PUR5_GEODF Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purM PE=3 SV=1 436 775 2.0E-98
sp|Q2SYY5|PUR5_BURTA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purM PE=3 SV=1 432 776 3.0E-98
sp|Q8EZT7|PUR2_LEPIN Phosphoribosylamine--glycine ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purD PE=3 SV=1 4 427 3.0E-98
sp|Q72V31|PUR2_LEPIC Phosphoribosylamine--glycine ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purD PE=3 SV=1 4 427 4.0E-98
sp|Q6LN73|PUR5_PHOPR Phosphoribosylformylglycinamidine cyclo-ligase OS=Photobacterium profundum GN=purM PE=3 SV=1 435 777 4.0E-98
sp|Q63R55|PUR5_BURPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain K96243) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|Q3JP21|PUR5_BURP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 1710b) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|A3NYW6|PUR5_BURP0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 1106a) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|A1V0V7|PUR5_BURMS Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain SAVP1) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|Q62HE4|PUR5_BURMA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain ATCC 23344) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|A2S554|PUR5_BURM9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain NCTC 10229) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|A3MN88|PUR5_BURM7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia mallei (strain NCTC 10247) GN=purM PE=3 SV=1 432 776 5.0E-98
sp|C5BP01|PUR5_TERTT Phosphoribosylformylglycinamidine cyclo-ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=purM PE=3 SV=1 438 778 6.0E-98
sp|Q1LJ92|PUR5_CUPMC Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purM PE=3 SV=1 436 776 6.0E-98
sp|Q8Z4R2|PUR5_SALTI Phosphoribosylformylglycinamidine cyclo-ligase OS=Salmonella typhi GN=purM PE=3 SV=3 435 771 7.0E-98
sp|C1DC84|PUR5_LARHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Laribacter hongkongensis (strain HLHK9) GN=purM PE=3 SV=1 434 768 1.0E-97
sp|Q9F1S9|PUR2_STRSU Phosphoribosylamine--glycine ligase OS=Streptococcus suis GN=purD PE=3 SV=1 4 429 1.0E-97
sp|Q7W0A7|PUR5_BORPE Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=purM PE=3 SV=1 436 776 1.0E-97
sp|Q7WG60|PUR5_BORBR Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=purM PE=3 SV=1 436 776 1.0E-97
sp|B2VE71|PUR5_ERWT9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purM PE=3 SV=1 435 764 1.0E-97
sp|Q32D69|PUR5_SHIDS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purM PE=3 SV=3 435 771 2.0E-97
sp|Q1R8N9|PUR5_ECOUT Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=purM PE=3 SV=3 435 771 2.0E-97
sp|B7MHY0|PUR5_ECO45 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=purM PE=3 SV=1 435 771 2.0E-97
sp|P08178|PUR5_ECOLI Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12) GN=purM PE=1 SV=3 435 771 2.0E-97
sp|B1XAX4|PUR5_ECODH Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12 / DH10B) GN=purM PE=3 SV=1 435 771 2.0E-97
sp|C4ZX74|PUR5_ECOBW Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purM PE=3 SV=1 435 771 2.0E-97
sp|B7MYC7|PUR5_ECO81 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O81 (strain ED1a) GN=purM PE=3 SV=1 435 771 2.0E-97
sp|Q0TEY9|PUR5_ECOL5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purM PE=3 SV=3 435 771 2.0E-97
sp|B5Z036|PUR5_ECO5E Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=purM PE=3 SV=1 435 771 2.0E-97
sp|Q8XAC5|PUR5_ECO57 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O157:H7 GN=purM PE=3 SV=3 435 771 2.0E-97
sp|Q46XJ9|PUR5_CUPPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purM PE=3 SV=1 436 776 2.0E-97
sp|Q3YZ53|PUR5_SHISS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella sonnei (strain Ss046) GN=purM PE=3 SV=3 435 771 3.0E-97
sp|Q83QL4|PUR5_SHIFL Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella flexneri GN=purM PE=3 SV=3 435 771 3.0E-97
sp|Q0T221|PUR5_SHIF8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|Q31XZ3|PUR5_SHIBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=purM PE=3 SV=3 435 771 3.0E-97
sp|B2TXS4|PUR5_SHIB3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B1LNF0|PUR5_ECOSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B7N681|PUR5_ECOLU Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B1IWG1|PUR5_ECOLC Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|Q8FF72|PUR5_ECOL6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purM PE=3 SV=3 435 771 3.0E-97
sp|A8A2Z1|PUR5_ECOHS Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O9:H4 (strain HS) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B7M7K3|PUR5_ECO8A Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O8 (strain IAI1) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B7LCN9|PUR5_ECO55 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain 55989 / EAEC) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|B6I571|PUR5_ECOSE Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain SE11) GN=purM PE=3 SV=1 435 771 3.0E-97
sp|Q0HTW8|PUR5_SHESR Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain MR-7) GN=purM PE=3 SV=1 433 768 4.0E-97
sp|B1KIG9|PUR5_SHEWM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=purM PE=3 SV=1 433 771 5.0E-97
sp|B7UGN7|PUR5_ECO27 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=purM PE=3 SV=1 435 771 5.0E-97
sp|B7NQN8|PUR5_ECO7I Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=purM PE=3 SV=1 435 771 5.0E-97
sp|A7ZPU2|PUR5_ECO24 Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=purM PE=3 SV=1 435 771 5.0E-97
sp|Q15SY3|PUR5_PSEA6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=purM PE=3 SV=1 435 764 5.0E-97
sp|Q7W4N4|PUR5_BORPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=purM PE=3 SV=1 436 776 6.0E-97
sp|C4LC65|PUR5_TOLAT Phosphoribosylformylglycinamidine cyclo-ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purM PE=3 SV=1 435 764 7.0E-97
sp|A6WM34|PUR5_SHEB8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS185) GN=purM PE=3 SV=1 433 768 7.0E-97
sp|A3ND57|PUR5_BURP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia pseudomallei (strain 668) GN=purM PE=3 SV=1 432 776 9.0E-97
sp|Q1QVP5|PUR5_CHRSD Phosphoribosylformylglycinamidine cyclo-ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=purM PE=3 SV=1 435 768 9.0E-97
sp|C5BHQ4|PUR5_EDWI9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Edwardsiella ictaluri (strain 93-146) GN=purM PE=3 SV=1 435 778 1.0E-96
sp|Q39UK1|PUR5_GEOMG Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purM PE=3 SV=1 431 770 1.0E-96
sp|O68186|PUR5_LACLM Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purM PE=3 SV=1 438 769 2.0E-96
sp|A6VMA4|PUR5_ACTSZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=purM PE=3 SV=1 431 777 3.0E-96
sp|P52424|PUR5_VIGUN Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial OS=Vigna unguiculata GN=PUR5 PE=2 SV=1 432 765 3.0E-96
sp|C4K4D1|PUR5_HAMD5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=purM PE=3 SV=1 435 762 3.0E-96
sp|B2JGD2|PUR5_BURP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purM PE=3 SV=1 434 776 4.0E-96
sp|Q0HHL6|PUR5_SHESM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain MR-4) GN=purM PE=3 SV=1 433 768 7.0E-96
sp|A0KYA3|PUR5_SHESA Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain ANA-3) GN=purM PE=3 SV=1 433 768 7.0E-96
sp|A8FUD3|PUR5_SHESH Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sediminis (strain HAW-EB3) GN=purM PE=3 SV=1 433 767 8.0E-96
sp|Q0K769|PUR5_CUPNH Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purM PE=3 SV=1 436 776 9.0E-96
sp|Q47Z78|PUR5_COLP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purM PE=3 SV=1 434 776 9.0E-96
sp|B3R6D1|PUR5_CUPTR Phosphoribosylformylglycinamidine cyclo-ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purM PE=3 SV=1 436 776 9.0E-96
sp|Q084L1|PUR5_SHEFN Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=purM PE=3 SV=1 433 768 1.0E-95
sp|B5FGY5|PUR5_VIBFM Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio fischeri (strain MJ11) GN=purM PE=3 SV=1 435 777 1.0E-95
sp|Q5E3H3|PUR5_VIBF1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purM PE=3 SV=1 435 777 1.0E-95
sp|B6EJU3|PUR5_ALISL Phosphoribosylformylglycinamidine cyclo-ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=purM PE=3 SV=1 435 777 1.0E-95
sp|Q9CFF4|PUR5_LACLA Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purM PE=3 SV=1 438 778 1.0E-95
sp|Q8EDI8|PUR5_SHEON Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella oneidensis (strain MR-1) GN=purM PE=3 SV=2 433 768 1.0E-95
sp|Q82Y02|PUR5_NITEU Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=purM PE=3 SV=1 436 768 2.0E-95
sp|Q2Y5R7|PUR5_NITMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=purM PE=3 SV=2 436 777 2.0E-95
sp|Q6AK63|PUR5_DESPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=purM PE=3 SV=1 438 764 2.0E-95
sp|Q5NXR0|PUR5_AROAE Phosphoribosylformylglycinamidine cyclo-ligase OS=Aromatoleum aromaticum (strain EbN1) GN=purM PE=3 SV=1 435 770 3.0E-95
sp|A0LA23|PUR5_MAGMM Phosphoribosylformylglycinamidine cyclo-ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=purM PE=3 SV=1 432 776 4.0E-95
sp|A9I602|PUR5_BORPD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=purM PE=3 SV=1 436 776 8.0E-95
sp|A1RKQ5|PUR5_SHESW Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella sp. (strain W3-18-1) GN=purM PE=3 SV=1 433 768 8.0E-95
sp|Q3JBW2|PUR5_NITOC Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purM PE=3 SV=1 429 767 9.0E-95
sp|A9KY38|PUR5_SHEB9 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS195) GN=purM PE=3 SV=1 433 768 9.0E-95
sp|A3D3D1|PUR5_SHEB5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=purM PE=3 SV=1 433 768 9.0E-95
sp|B8EAL4|PUR5_SHEB2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella baltica (strain OS223) GN=purM PE=3 SV=1 433 768 9.0E-95
sp|A9AGA9|PUR5_BURM1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purM PE=3 SV=1 432 776 1.0E-94
sp|B4REI0|PUR2_PHEZH Phosphoribosylamine--glycine ligase OS=Phenylobacterium zucineum (strain HLK1) GN=purD PE=3 SV=1 4 428 1.0E-94
sp|Q0ADT8|PUR5_NITEC Phosphoribosylformylglycinamidine cyclo-ligase OS=Nitrosomonas eutropha (strain C91) GN=purM PE=3 SV=1 436 776 1.0E-94
sp|A4Y5T8|PUR5_SHEPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=purM PE=3 SV=1 433 768 2.0E-94
sp|A1S7E6|PUR5_SHEAM Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purM PE=3 SV=1 433 768 2.0E-94
sp|Q5FIV3|PUR5_LACAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purM PE=3 SV=1 438 777 3.0E-94
sp|Q3IIQ2|PUR5_PSEHT Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=purM PE=3 SV=1 434 764 4.0E-94
sp|Q60BU2|PUR5_METCA Phosphoribosylformylglycinamidine cyclo-ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=purM PE=3 SV=1 433 768 4.0E-94
sp|A3QD32|PUR5_SHELP Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purM PE=3 SV=1 433 767 9.0E-94
sp|B4EDH7|PUR5_BURCJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purM PE=3 SV=1 432 776 1.0E-93
sp|B2GF76|PUR5_LACF3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=purM PE=3 SV=1 438 777 1.0E-93
sp|Q6GI10|PUR2_STAAR Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MRSA252) GN=purD PE=3 SV=1 4 429 1.0E-93
sp|B0TPW7|PUR5_SHEHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=purM PE=3 SV=1 436 767 2.0E-93
sp|Q9CPL6|PUR5_PASMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Pasteurella multocida (strain Pm70) GN=purM PE=3 SV=1 431 777 2.0E-93
sp|A8FAM9|PUR5_BACP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus pumilus (strain SAFR-032) GN=purM PE=3 SV=1 438 762 2.0E-93
sp|Q39JB9|PUR5_BURL3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purM PE=3 SV=1 432 776 2.0E-93
sp|A8H5R0|PUR5_SHEPA Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purM PE=3 SV=1 436 767 2.0E-93
sp|Q0BI09|PUR5_BURCM Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purM PE=3 SV=1 432 776 3.0E-93
sp|Q31GT2|PUR5_THICR Phosphoribosylformylglycinamidine cyclo-ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=purM PE=3 SV=1 434 772 3.0E-93
sp|B1YTV3|PUR5_BURA4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia ambifaria (strain MC40-6) GN=purM PE=3 SV=1 432 776 4.0E-93
sp|A0K4T7|PUR5_BURCH Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain HI2424) GN=purM PE=3 SV=1 432 776 4.0E-93
sp|B1JW28|PUR5_BURCC Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=purM PE=3 SV=1 432 776 4.0E-93
sp|Q1BYW4|PUR5_BURCA Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=purM PE=3 SV=1 432 776 4.0E-93
sp|A9FYZ4|PUR5_SORC5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Sorangium cellulosum (strain So ce56) GN=purM PE=3 SV=1 435 765 4.0E-93
sp|A5UEU3|PUR5_HAEIG Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain PittGG) GN=purM PE=3 SV=1 431 777 5.0E-93
sp|Q3A515|PUR5_PELCD Phosphoribosylformylglycinamidine cyclo-ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purM PE=3 SV=1 434 772 6.0E-93
sp|P43848|PUR5_HAEIN Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purM PE=3 SV=1 431 764 7.0E-93
sp|Q5QUP9|PUR5_IDILO Phosphoribosylformylglycinamidine cyclo-ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=purM PE=3 SV=1 435 771 9.0E-93
sp|A7GKI0|PUR5_BACCN Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purM PE=3 SV=1 435 765 1.0E-92
sp|Q9RKL4|PUR2_STRCO Phosphoribosylamine--glycine ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purD PE=3 SV=1 4 427 1.0E-92
sp|P65896|PUR2_STAAN Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain N315) GN=purD PE=1 SV=1 4 429 2.0E-92
sp|P65895|PUR2_STAAM Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purD PE=3 SV=1 4 429 2.0E-92
sp|B8CN80|PUR5_SHEPW Phosphoribosylformylglycinamidine cyclo-ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purM PE=3 SV=1 436 767 2.0E-92
sp|Q74CB6|PUR5_GEOSL Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purM PE=3 SV=1 431 770 2.0E-92
sp|Q311C7|PUR5_DESAG Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfovibrio alaskensis (strain G20) GN=purM PE=3 SV=1 433 757 2.0E-92
sp|Q8XW52|PUR5_RALSO Phosphoribosylformylglycinamidine cyclo-ligase OS=Ralstonia solanacearum (strain GMI1000) GN=purM PE=3 SV=1 432 776 2.0E-92
sp|Q97TA2|PUR5_STRPN Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purM PE=1 SV=1 438 769 4.0E-92
sp|Q21VH4|PUR5_RHOFT Phosphoribosylformylglycinamidine cyclo-ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=purM PE=3 SV=1 436 741 4.0E-92
sp|C1CBM4|PUR5_STRZJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain JJA) GN=purM PE=3 SV=1 438 769 4.0E-92
sp|B8ZJN0|PUR5_STRPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purM PE=3 SV=1 438 769 4.0E-92
sp|B1I7V5|PUR5_STRPI Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purM PE=3 SV=1 438 769 4.0E-92
sp|C1C9V1|PUR5_STRP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain 70585) GN=purM PE=3 SV=1 438 769 4.0E-92
sp|Q5HH10|PUR2_STAAC Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain COL) GN=purD PE=3 SV=1 4 429 5.0E-92
sp|B0BQ30|PUR5_ACTPJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=purM PE=3 SV=1 436 764 5.0E-92
sp|A3N1A1|PUR5_ACTP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=purM PE=3 SV=1 436 764 5.0E-92
sp|B2IR37|PUR5_STRPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=purM PE=3 SV=1 438 769 5.0E-92
sp|Q9RUF5|PUR2_DEIRA Phosphoribosylamine--glycine ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purD PE=3 SV=2 4 426 6.0E-92
sp|Q2RGU7|PUR5_MOOTA Phosphoribosylformylglycinamidine cyclo-ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=purM PE=3 SV=1 431 766 6.0E-92
sp|Q6GAD9|PUR2_STAAS Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MSSA476) GN=purD PE=3 SV=1 4 429 6.0E-92
sp|C1CNS6|PUR5_STRZT Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purM PE=3 SV=1 438 769 8.0E-92
sp|Q8ES94|PUR5_OCEIH Phosphoribosylformylglycinamidine cyclo-ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purM PE=3 SV=1 437 768 9.0E-92
sp|Q4QKF3|PUR5_HAEI8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain 86-028NP) GN=purM PE=3 SV=1 431 777 9.0E-92
sp|Q8CT26|PUR2_STAES Phosphoribosylamine--glycine ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purD PE=3 SV=2 4 427 9.0E-92
sp|Q5HQ96|PUR2_STAEQ Phosphoribosylamine--glycine ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purD PE=3 SV=1 4 427 9.0E-92
sp|B9DSR4|PUR5_STRU0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=purM PE=3 SV=1 434 768 1.0E-91
sp|B4SN29|PUR5_STRM5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=purM PE=3 SV=1 432 755 1.0E-91
sp|B5E5J6|PUR5_STRP4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purM PE=3 SV=1 438 769 2.0E-91
sp|Q8NX87|PUR2_STAAW Phosphoribosylamine--glycine ligase OS=Staphylococcus aureus (strain MW2) GN=purD PE=3 SV=1 4 429 2.0E-91
sp|A0KM24|PUR5_AERHH Phosphoribosylformylglycinamidine cyclo-ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=purM PE=3 SV=1 435 777 2.0E-91
sp|Q63GT1|PUR5_BACCZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ZK / E33L) GN=purM PE=3 SV=1 435 761 2.0E-91
sp|Q8DRM4|PUR5_STRR6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purM PE=3 SV=1 438 769 2.0E-91
sp|Q04N22|PUR5_STRP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purM PE=3 SV=1 438 769 2.0E-91
sp|B4RZX7|PUR5_ALTMD Phosphoribosylformylglycinamidine cyclo-ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=purM PE=3 SV=1 435 768 2.0E-91
sp|P12043|PUR5_BACSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus subtilis (strain 168) GN=purM PE=3 SV=2 438 762 2.0E-91
sp|Q48FI4|PUR5_PSE14 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=purM PE=3 SV=1 435 780 2.0E-91
sp|Q65UX7|PUR5_MANSM Phosphoribosylformylglycinamidine cyclo-ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=purM PE=3 SV=1 431 777 2.0E-91
sp|A4SL28|PUR5_AERS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Aeromonas salmonicida (strain A449) GN=purM PE=3 SV=1 435 777 3.0E-91
sp|A3CJZ4|PUR5_STRSV Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus sanguinis (strain SK36) GN=purM PE=3 SV=1 438 769 4.0E-91
sp|B2T067|PUR5_BURPP Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purM PE=3 SV=1 434 776 4.0E-91
sp|A9VRF3|PUR5_BACWK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=purM PE=3 SV=1 435 765 4.0E-91
sp|C1CHV9|PUR5_STRZP Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae (strain P1031) GN=purM PE=3 SV=1 438 769 4.0E-91
sp|A5UC39|PUR5_HAEIE Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus influenzae (strain PittEE) GN=purM PE=3 SV=1 431 777 4.0E-91
sp|Q5WJ84|PUR5_BACSK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus clausii (strain KSM-K16) GN=purM PE=3 SV=1 438 768 4.0E-91
sp|B2FRX8|PUR5_STRMK Phosphoribosylformylglycinamidine cyclo-ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=purM PE=3 SV=1 432 768 6.0E-91
sp|A4JBT0|PUR5_BURVG Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purM PE=3 SV=1 432 776 6.0E-91
sp|Q4ZQ51|PUR5_PSEU2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=purM PE=3 SV=1 435 780 7.0E-91
sp|Q7NMP5|PUR5_GLOVI Phosphoribosylformylglycinamidine cyclo-ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=purM PE=3 SV=1 436 765 7.0E-91
sp|Q47B77|PUR5_DECAR Phosphoribosylformylglycinamidine cyclo-ligase OS=Dechloromonas aromatica (strain RCB) GN=purM PE=3 SV=1 435 767 8.0E-91
sp|Q885Y1|PUR5_PSESM Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purM PE=3 SV=1 435 780 9.0E-91
sp|Q6F973|PUR5_ACIAD Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=purM PE=3 SV=1 436 764 1.0E-90
sp|A7Z251|PUR5_BACMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purM PE=3 SV=1 438 770 1.0E-90
sp|B8DNV5|PUR5_DESVM Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=purM PE=3 SV=1 438 764 1.0E-90
sp|Q67KG0|PUR5_SYMTH Phosphoribosylformylglycinamidine cyclo-ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purM PE=3 SV=1 431 778 1.0E-90
sp|Q145C6|PUR5_BURXL Phosphoribosylformylglycinamidine cyclo-ligase OS=Burkholderia xenovorans (strain LB400) GN=purM PE=3 SV=1 434 776 2.0E-90
sp|A8F8I1|PUR5_PSELT Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=purM PE=3 SV=1 436 770 2.0E-90
sp|C0ZKC8|PUR5_BREBN Phosphoribosylformylglycinamidine cyclo-ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=purM PE=3 SV=1 438 769 2.0E-90
sp|A8YW83|PUR5_LACH4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=purM PE=3 SV=1 438 777 2.0E-90
sp|A1KA97|PUR5_AZOSB Phosphoribosylformylglycinamidine cyclo-ligase OS=Azoarcus sp. (strain BH72) GN=purM PE=3 SV=1 438 776 3.0E-90
sp|Q0I5D1|PUR5_HAES1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus somnus (strain 129Pt) GN=purM PE=3 SV=1 431 764 3.0E-90
sp|Q6HPA2|PUR5_BACHK Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purM PE=3 SV=1 435 752 3.0E-90
sp|Q81IQ1|PUR5_BACCR Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purM PE=3 SV=1 435 761 3.0E-90
sp|B7H4T8|PUR5_BACC4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain B4264) GN=purM PE=3 SV=1 435 761 3.0E-90
sp|C1EV65|PUR5_BACC3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain 03BB102) GN=purM PE=3 SV=1 435 752 4.0E-90
sp|B7JM87|PUR5_BACC0 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain AH820) GN=purM PE=3 SV=1 435 752 4.0E-90
sp|Q81ZH0|PUR5_BACAN Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis GN=purM PE=1 SV=1 435 752 4.0E-90
sp|A0R8Z8|PUR5_BACAH Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=purM PE=3 SV=1 435 752 4.0E-90
sp|C3L534|PUR5_BACAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purM PE=3 SV=1 435 752 4.0E-90
sp|C3PBN2|PUR5_BACAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus anthracis (strain A0248) GN=purM PE=3 SV=1 435 752 4.0E-90
sp|Q1MRM4|PUR5_LAWIP Phosphoribosylformylglycinamidine cyclo-ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=purM PE=3 SV=1 435 776 4.0E-90
sp|B0URN5|PUR5_HISS2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Histophilus somni (strain 2336) GN=purM PE=3 SV=1 431 764 5.0E-90
sp|A1A0R8|PUR5_BIFAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=purM PE=3 SV=1 438 767 5.0E-90
sp|A8AU99|PUR5_STRGC Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purM PE=3 SV=1 438 769 5.0E-90
sp|Q8RC57|PUR5_CALS4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purM PE=3 SV=1 436 770 7.0E-90
sp|Q8G595|PUR5_BIFLO Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum (strain NCC 2705) GN=purM PE=3 SV=1 438 770 1.0E-89
sp|B3DT56|PUR5_BIFLD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum (strain DJO10A) GN=purM PE=3 SV=1 438 770 1.0E-89
sp|Q3BQX8|PUR5_XANC5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purM PE=3 SV=1 436 766 1.0E-89
sp|B9J1K7|PUR5_BACCQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain Q1) GN=purM PE=3 SV=1 435 752 1.0E-89
sp|Q73EN3|PUR5_BACC1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purM PE=3 SV=1 435 752 1.0E-89
sp|B7HS34|PUR5_BACC7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain AH187) GN=purM PE=3 SV=1 435 752 2.0E-89
sp|B8F5E6|PUR5_HAEPS Phosphoribosylformylglycinamidine cyclo-ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=purM PE=3 SV=1 436 764 2.0E-89
sp|Q8E7W9|PUR5_STRA3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purM PE=3 SV=1 434 767 2.0E-89
sp|Q833Z1|PUR5_ENTFA Phosphoribosylformylglycinamidine cyclo-ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purM PE=3 SV=1 438 768 3.0E-89
sp|B0K3Q6|PUR5_THEPX Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermoanaerobacter sp. (strain X514) GN=purM PE=3 SV=1 436 770 3.0E-89
sp|Q71YQ1|PUR5_LISMF Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purM PE=3 SV=1 438 769 3.0E-89
sp|C1KW66|PUR5_LISMC Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purM PE=3 SV=1 438 769 3.0E-89
sp|B7K0I0|PUR5_CYAP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain PCC 8801) GN=purM PE=3 SV=1 436 752 4.0E-89
sp|B7GU81|PUR5_BIFLS Phosphoribosylformylglycinamidine cyclo-ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=purM PE=3 SV=1 438 770 4.0E-89
sp|B7IUV5|PUR5_BACC2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus cereus (strain G9842) GN=purM PE=3 SV=1 435 752 5.0E-89
sp|Q8E2G1|PUR5_STRA5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purM PE=3 SV=1 434 767 6.0E-89
sp|Q2LTT5|PUR5_SYNAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Syntrophus aciditrophicus (strain SB) GN=purM PE=3 SV=1 434 764 9.0E-89
sp|A6TLS5|PUR5_ALKMQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=purM PE=3 SV=1 431 752 9.0E-89
sp|B0VDJ1|PUR5_ACIBY Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AYE) GN=purM PE=3 SV=1 436 764 2.0E-88
sp|A3M7X8|PUR5_ACIBT Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=purM PE=3 SV=2 436 764 2.0E-88
sp|B0VT70|PUR5_ACIBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain SDF) GN=purM PE=3 SV=1 436 764 2.0E-88
sp|B2HWV2|PUR5_ACIBC Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain ACICU) GN=purM PE=3 SV=1 436 764 2.0E-88
sp|B7I5C6|PUR5_ACIB5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AB0057) GN=purM PE=3 SV=1 436 764 2.0E-88
sp|B7GY98|PUR5_ACIB3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=purM PE=3 SV=1 436 764 2.0E-88
sp|Q55422|PUR5_SYNY3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purM PE=3 SV=1 436 744 2.0E-88
sp|Q9F1T6|PUR5_STRSU Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus suis GN=purM PE=3 SV=1 438 768 2.0E-88
sp|Q9A1Z0|PUR5_STRP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M1 GN=purM PE=3 SV=1 434 767 2.0E-88
sp|B2G5C0|PUR5_LACRJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=purM PE=3 SV=1 438 764 2.0E-88
sp|A5VHU0|PUR5_LACRD Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=purM PE=3 SV=1 438 764 2.0E-88
sp|B8DDZ0|PUR5_LISMH Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purM PE=3 SV=1 438 769 3.0E-88
sp|B8I492|PUR5_CLOCE Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=purM PE=3 SV=1 437 774 4.0E-88
sp|Q3K400|PUR5_STRA1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purM PE=3 SV=1 434 767 4.0E-88
sp|Q0VP77|PUR5_ALCBS Phosphoribosylformylglycinamidine cyclo-ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purM PE=3 SV=1 436 779 4.0E-88
sp|A0AJM1|PUR5_LISW6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purM PE=3 SV=1 438 769 6.0E-88
sp|Q93MM7|PUR5_LACSS Phosphoribosylformylglycinamidine cyclo-ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=purM PE=3 SV=1 438 769 8.0E-88
sp|B0KBQ3|PUR5_THEP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purM PE=3 SV=1 436 770 8.0E-88
sp|B5XJ18|PUR5_STRPZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purM PE=3 SV=1 434 767 1.0E-87
sp|P0DD63|PUR5_STRPQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purM PE=3 SV=1 434 767 1.0E-87
sp|P0DD62|PUR5_STRP3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purM PE=3 SV=1 434 767 1.0E-87
sp|Q48VX3|PUR5_STRPM Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purM PE=3 SV=1 434 767 1.0E-87
sp|C4L2A1|PUR5_EXISA Phosphoribosylformylglycinamidine cyclo-ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=purM PE=3 SV=1 435 776 1.0E-87
sp|Q1JJ82|PUR5_STRPD Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purM PE=3 SV=1 434 767 1.0E-87
sp|A4XWN5|PUR5_PSEMY Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas mendocina (strain ymp) GN=purM PE=3 SV=1 435 780 1.0E-87
sp|Q92AP1|PUR5_LISIN Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purM PE=3 SV=1 438 767 2.0E-87
sp|Q1J936|PUR5_STRPF Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purM PE=3 SV=1 434 767 2.0E-87
sp|Q8P312|PUR5_STRP8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purM PE=3 SV=1 434 767 2.0E-87
sp|Q1JE80|PUR5_STRPB Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purM PE=3 SV=1 434 767 2.0E-87
sp|Q83AZ0|PUR5_COXBU Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=purM PE=3 SV=1 436 776 2.0E-87
sp|A9NA98|PUR5_COXBR Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=purM PE=3 SV=1 436 776 2.0E-87
sp|Q4K8A5|PUR5_PSEF5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purM PE=3 SV=1 435 780 3.0E-87
sp|Q5XEF4|PUR5_STRP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purM PE=3 SV=1 434 767 3.0E-87
sp|A9KBZ3|PUR5_COXBN Phosphoribosylformylglycinamidine cyclo-ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=purM PE=3 SV=1 436 776 3.0E-87
sp|Q8Y6C3|PUR5_LISMO Phosphoribosylformylglycinamidine cyclo-ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purM PE=3 SV=1 438 768 4.0E-87
sp|Q9PFS0|PUR5_XYLFA Phosphoribosylformylglycinamidine cyclo-ligase OS=Xylella fastidiosa (strain 9a5c) GN=purM PE=3 SV=1 438 752 4.0E-87
sp|Q0ABB7|PUR5_ALKEH Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=purM PE=3 SV=1 434 772 5.0E-87
sp|Q5L3D0|PUR5_GEOKA Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus kaustophilus (strain HTA426) GN=purM PE=1 SV=1 435 745 5.0E-87
sp|C1DRW0|PUR5_AZOVD Phosphoribosylformylglycinamidine cyclo-ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purM PE=3 SV=1 435 764 6.0E-87
sp|C3K102|PUR5_PSEFS Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain SBW25) GN=purM PE=3 SV=1 435 780 7.0E-87
sp|Q8PID9|PUR5_XANAC Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purM PE=3 SV=1 436 738 8.0E-87
sp|A4XKZ4|PUR5_CALS8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purM PE=3 SV=1 437 777 2.0E-86
sp|Q3AD62|PUR5_CARHZ Phosphoribosylformylglycinamidine cyclo-ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=purM PE=3 SV=1 434 769 2.0E-86
sp|Q5N490|PUR5_SYNP6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purM PE=3 SV=2 436 742 2.0E-86
sp|Q31PY7|PUR5_SYNE7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus elongatus (strain PCC 7942) GN=purM PE=3 SV=1 436 742 2.0E-86
sp|A2RBZ5|PUR5_STRPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=purM PE=3 SV=1 434 767 2.0E-86
sp|Q8DWL1|PUR5_STRMU Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purM PE=3 SV=1 434 767 3.0E-86
sp|B1YJ07|PUR5_EXIS2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=purM PE=3 SV=1 438 764 3.0E-86
sp|Q88U30|PUR2_LACPL Phosphoribosylamine--glycine ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purD PE=3 SV=1 5 423 3.0E-86
sp|Q02IA6|PUR5_PSEAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purM PE=3 SV=1 435 764 5.0E-86
sp|B7UXY9|PUR5_PSEA8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=purM PE=3 SV=1 435 764 5.0E-86
sp|Q9I513|PUR5_PSEAE Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purM PE=3 SV=1 435 764 6.0E-86
sp|Q87B94|PUR5_XYLFT Phosphoribosylformylglycinamidine cyclo-ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purM PE=3 SV=1 438 752 7.0E-86
sp|Q24QH4|PUR5_DESHY Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfitobacterium hafniense (strain Y51) GN=purM PE=3 SV=1 437 770 1.0E-85
sp|B8FP03|PUR5_DESHD Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purM PE=3 SV=1 437 770 1.0E-85
sp|Q5H3C0|PUR5_XANOR Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purM PE=3 SV=2 436 766 1.0E-85
sp|B2SJY0|PUR5_XANOP Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purM PE=3 SV=1 436 766 1.0E-85
sp|Q2P674|PUR5_XANOM Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purM PE=3 SV=1 436 766 1.0E-85
sp|A4IJX5|PUR5_GEOTN Phosphoribosylformylglycinamidine cyclo-ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=purM PE=3 SV=1 438 765 3.0E-85
sp|B7KJK8|PUR5_CYAP7 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain PCC 7424) GN=purM PE=3 SV=1 436 765 4.0E-85
sp|B1WPZ0|PUR5_CYAA5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain ATCC 51142) GN=purM PE=3 SV=1 436 744 4.0E-85
sp|Q3KFT0|PUR5_PSEPF Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=purM PE=3 SV=1 435 764 5.0E-85
sp|B0RQI6|PUR5_XANCB Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=purM PE=3 SV=1 436 738 7.0E-85
sp|Q0AW29|PUR5_SYNWW Phosphoribosylformylglycinamidine cyclo-ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=purM PE=3 SV=1 436 780 9.0E-85
sp|Q65MS6|PUR5_BACLD Phosphoribosylformylglycinamidine cyclo-ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=purM PE=3 SV=2 437 762 9.0E-85
sp|Q8P725|PUR5_XANCP Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purM PE=3 SV=1 436 738 1.0E-84
sp|Q4UX30|PUR5_XANC8 Phosphoribosylformylglycinamidine cyclo-ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purM PE=3 SV=1 436 738 1.0E-84
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 411 779 2.0E-84
sp|Q1JP36|PUR5_STRPC Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purM PE=3 SV=1 434 767 4.0E-84
sp|B1XNH7|PUR5_SYNP2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=purM PE=3 SV=1 436 765 4.0E-84
sp|B1HTV6|PUR5_LYSSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=purM PE=3 SV=1 438 765 5.0E-84
sp|Q1IDL2|PUR5_PSEE4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas entomophila (strain L48) GN=purM PE=3 SV=1 435 755 6.0E-84
sp|Q03MZ8|PUR5_STRTD Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purM PE=3 SV=1 438 768 8.0E-84
sp|Q5M6J5|PUR5_STRT2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=purM PE=3 SV=1 438 768 1.0E-83
sp|Q5M203|PUR5_STRT1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=purM PE=3 SV=1 438 768 1.0E-83
sp|B0JTF5|PUR5_MICAN Phosphoribosylformylglycinamidine cyclo-ligase OS=Microcystis aeruginosa (strain NIES-843) GN=purM PE=3 SV=1 436 765 2.0E-83
sp|B1J1M3|PUR5_PSEPW Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain W619) GN=purM PE=3 SV=1 435 780 3.0E-83
sp|B8FJY6|PUR5_DESAA Phosphoribosylformylglycinamidine cyclo-ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=purM PE=3 SV=1 434 767 3.0E-83
sp|A3DEV1|PUR5_CLOTH Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=purM PE=3 SV=1 437 774 4.0E-83
sp|Q88MA9|PUR5_PSEPK Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain KT2440) GN=purM PE=3 SV=1 435 780 6.0E-83
sp|B0KT52|PUR5_PSEPG Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain GB-1) GN=purM PE=3 SV=1 435 780 6.0E-83
sp|A5W7R7|PUR5_PSEP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purM PE=3 SV=1 435 780 6.0E-83
sp|B9EAZ0|PUR5_MACCJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=purM PE=3 SV=1 435 765 7.0E-83
sp|Q49WJ5|PUR5_STAS1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purM PE=3 SV=1 438 765 1.0E-82
sp|B9MS91|PUR5_CALBD Phosphoribosylformylglycinamidine cyclo-ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purM PE=3 SV=1 437 777 1.0E-82
sp|A5N0Q2|PUR5_CLOK5 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purM PE=3 SV=1 436 769 1.0E-82
sp|B9E4K8|PUR5_CLOK1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=purM PE=3 SV=1 436 769 1.0E-82
sp|A0Q1J2|PUR5_CLONN Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium novyi (strain NT) GN=purM PE=3 SV=1 437 777 3.0E-82
sp|Q05728|PUR5_ARATH Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic OS=Arabidopsis thaliana GN=PUR5 PE=1 SV=2 434 768 6.0E-82
sp|A9KHX3|PUR5_CLOPH Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=purM PE=3 SV=1 436 774 1.0E-81
sp|C4Z478|PUR5_EUBE2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=purM PE=3 SV=1 436 774 1.0E-81
sp|C3L2V1|PUR5_CLOB6 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=purM PE=3 SV=1 436 762 1.0E-81
sp|Q4L580|PUR5_STAHJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purM PE=3 SV=1 438 765 2.0E-81
sp|Q8NMH3|PUR2_CORGL Phosphoribosylamine--glycine ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purD PE=3 SV=1 4 429 2.0E-81
sp|A8MLI7|PUR5_ALKOO Phosphoribosylformylglycinamidine cyclo-ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=purM PE=3 SV=1 436 765 4.0E-81
sp|B1IL59|PUR5_CLOBK Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=purM PE=3 SV=1 436 762 8.0E-81
sp|A7HDB7|PUR5_ANADF Phosphoribosylformylglycinamidine cyclo-ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purM PE=3 SV=1 435 740 8.0E-81
sp|A7GH98|PUR5_CLOBL Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purM PE=3 SV=1 436 762 1.0E-80
sp|Q9RHX4|PUR2_CORAM Phosphoribosylamine--glycine ligase OS=Corynebacterium ammoniagenes GN=purD PE=3 SV=1 4 427 1.0E-80
sp|Q8XMK4|PUR5_CLOPE Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium perfringens (strain 13 / Type A) GN=purM PE=3 SV=1 436 764 1.0E-80
sp|C1FV78|PUR5_CLOBJ Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purM PE=3 SV=1 436 762 1.0E-80
sp|A7FXD5|PUR5_CLOB1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purM PE=3 SV=1 436 762 1.0E-80
sp|Q0TTB2|PUR5_CLOP1 Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=purM PE=3 SV=1 436 764 2.0E-80
sp|B5YKG0|PUR5_THEYD Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=purM PE=3 SV=1 435 744 4.0E-80
sp|B1KZ57|PUR5_CLOBM Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=purM PE=3 SV=1 436 762 1.0E-79
sp|B0S0R2|PUR5_FINM2 Phosphoribosylformylglycinamidine cyclo-ligase OS=Finegoldia magna (strain ATCC 29328) GN=purM PE=3 SV=1 436 736 2.0E-79
sp|Q8DHY2|PUR5_THEEB Phosphoribosylformylglycinamidine cyclo-ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=purM PE=3 SV=1 436 747 2.0E-79
sp|Q8CT29|PUR5_STAES Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purM PE=3 SV=1 438 765 3.0E-79
sp|Q5HQ99|PUR5_STAEQ Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purM PE=3 SV=1 438 765 3.0E-79
sp|Q892X1|PUR5_CLOTE Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=purM PE=3 SV=1 437 777 3.0E-79
sp|C4ZH75|PUR5_EUBR3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=purM PE=3 SV=1 436 770 8.0E-79
sp|Q97J93|PUR5_CLOAB Phosphoribosylformylglycinamidine cyclo-ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purM PE=3 SV=1 436 762 3.0E-78
sp|Q3AMJ2|PUR5_SYNSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain CC9605) GN=purM PE=3 SV=2 436 771 2.0E-77
sp|A5GVR5|PUR5_SYNR3 Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain RCC307) GN=purM PE=3 SV=1 436 740 3.0E-77
sp|B8HPV7|PUR5_CYAP4 Phosphoribosylformylglycinamidine cyclo-ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=purM PE=3 SV=1 436 756 5.0E-77
sp|A5GIY3|PUR5_SYNPW Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain WH7803) GN=purM PE=3 SV=1 436 775 7.0E-77
sp|Q1D8V5|PUR5_MYXXD Phosphoribosylformylglycinamidine cyclo-ligase OS=Myxococcus xanthus (strain DK 1622) GN=purM PE=3 SV=1 437 776 1.0E-75
sp|B9DQ40|PUR5_STACT Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus carnosus (strain TM300) GN=purM PE=3 SV=1 435 752 1.0E-75
sp|Q8NX90|PUR5_STAAW Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain MW2) GN=purM PE=3 SV=1 438 768 1.0E-75
sp|Q6GAE2|PUR5_STAAS Phosphoribosylformylglycinamidine cyclo-ligase OS=Staphylococcus aureus (strain MSSA476) GN=purM PE=3 SV=1 438 768 1.0E-75
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 489 780 8.0E-68
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 489 776 1.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0009113 purine nucleobase biosynthetic process Yes
GO:0004637 phosphoribosylamine-glycine ligase activity Yes
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046112 nucleobase biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009112 nucleobase metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0044249 cellular biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0042440 pigment metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006144 purine nucleobase metabolic process No
GO:0003824 catalytic activity No
GO:0019438 aromatic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046148 pigment biosynthetic process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3455
MADLRVLLIGSGGREHALAWKLSQSPRVASIFVVPGNGGTATCPKATNVTSVSADDFAGLVGFSQANGVNLVVPG
PEAPLVSGVEAFFRRAGIPCFGPSKEAARLEGSKTYSKDFMKKYGIPTAAYENFADHDGAVAYVDRVAHDVVIKA
TGLAAGKGVIIPRTKDEAREALKQIMVDRAFGAAGDEVVIEELLVGDELSVLSFCDGYTIKSLPLAQDHKRIFDG
DQGPNTGGMGCYAPTNIATKDLMDRINGEILEPTISGMRRERQPFRGVLFTGLMITSTGPKVLEYNVRFGDPETQ
TVLPLLSADTDLADIMLACAEGYLDNCRLTVEDKFSATVVLAAAGYPGSYPKGTPMAVRAPPSGSTIFHAGTKLE
GDQLTTSGGRVIAITSTADSLRAAVDSCYAALSSKVIDFEGMFYRKDIAHRAFRELAPEAMTYAQAGVDIRAGNE
FVDKIKKAVASTRRPGADAEIGGFGGELDLSQCGYPGAPVLVGAIDGVGTKLMIAQSVRRHDTVGIDLVAMNVND
LIVQGATPLMFLDYYGCSKLDLPSAASFVEGVADGCRQAGCALVGGETAEMPGMYRGEDYDAAGCAVGAVMASRR
LPRKDAMVRGDVLLGLASNGVHSNGFSLVRRIVQRAGLDYGDRAPWDESQTVGQALLTPTRIYVKSLLPVLDQIK
GLAHITGGGLVENVPRMLPEGLAAEIDFGSWDVPDVFRWLKTSGAVAPAEMCLTFNAGIGMVIAVEADKADAVAR
ALGASEKVFRLGSLVPREQGQPGCVIRRLECWA*
Coding >Hirsu2|3455
ATGGCCGACCTTCGCGTCCTGCTCATCGGTAGTGGCGGCCGCGAGCACGCCCTGGCCTGGAAGCTAAGCCAGTCG
CCGCGCGTTGCGTCGATTTTCGTAGTGCCCGGCAACGGGGGCACCGCGACCTGTCCCAAGGCGACCAATGTCACG
TCCGTCTCGGCCGACGACTTCGCCGGCCTCGTCGGCTTCTCCCAGGCCAACGGCGTCAACCTGGTGGTACCCGGG
CCCGAGGCGCCGCTCGTGAGCGGTGTCGAGGCCTTCTTCCGGAGGGCCGGCATCCCGTGCTTCGGGCCGTCCAAG
GAGGCGGCCCGGCTGGAGGGCAGCAAGACGTACTCGAAGGACTTCATGAAGAAGTACGGCATCCCCACGGCGGCC
TACGAAAACTTCGCCGACCACGACGGTGCCGTCGCGTACGTCGACCGCGTCGCGCACGACGTCGTCATCAAGGCC
ACCGGCCTGGCCGCCGGCAAGGGCGTCATCATCCCGCGGACCAAGGACGAGGCCAGGGAGGCGCTGAAGCAGATC
ATGGTCGACAGGGCCTTCGGCGCCGCCGGGGACGAGGTCGTCATCGAGGAGCTCCTGGTCGGGGACGAGCTGAGC
GTCCTCAGCTTCTGCGACGGCTACACGATCAAGTCGCTGCCGCTCGCCCAGGACCACAAGAGGATCTTCGACGGG
GACCAGGGCCCCAACACGGGCGGCATGGGCTGCTACGCGCCCACCAACATCGCCACCAAGGACCTGATGGACAGG
ATCAACGGGGAGATCCTCGAGCCCACCATCTCGGGCATGCGCCGCGAGAGGCAACCGTTCCGCGGCGTCCTGTTC
ACCGGCCTCATGATCACCAGCACCGGCCCCAAGGTCTTGGAGTACAACGTCCGGTTCGGGGACCCCGAAACCCAG
ACCGTCCTGCCCCTGCTCTCCGCCGATACCGACCTCGCCGACATCATGCTCGCCTGCGCCGAGGGCTACCTGGAC
AACTGCCGCCTCACGGTCGAGGACAAATTCAGCGCCACCGTCGTGCTGGCCGCCGCCGGCTATCCTGGCTCCTAC
CCCAAGGGGACCCCGATGGCCGTGCGCGCTCCCCCCAGCGGAAGCACAATCTTCCACGCGGGCACCAAGCTCGAG
GGCGATCAGTTGACGACGTCTGGCGGCCGGGTCATCGCCATCACTTCCACCGCCGACTCCCTGCGAGCGGCCGTC
GACTCGTGCTACGCCGCCCTTTCCTCCAAAGTGATAGACTTCGAGGGCATGTTCTACCGGAAGGACATCGCTCAT
CGTGCTTTCAGGGAGCTGGCTCCGGAAGCCATGACGTACGCCCAGGCCGGCGTGGACATCCGGGCCGGGAACGAG
TTCGTGGACAAGATCAAGAAGGCGGTCGCCAGCACCAGGCGTCCCGGCGCCGACGCCGAGATTGGCGGTTTCGGC
GGCGAACTCGACCTCTCGCAGTGCGGGTATCCGGGCGCCCCCGTCCTGGTCGGCGCCATCGACGGCGTCGGAACG
AAGCTGATGATTGCGCAGTCGGTGCGACGTCACGACACGGTGGGCATCGACCTGGTGGCCATGAACGTCAACGAC
CTGATTGTGCAGGGGGCGACGCCGCTCATGTTCCTAGACTACTACGGCTGCAGCAAACTGGACCTGCCCTCGGCG
GCTTCCTTCGTCGAGGGCGTCGCCGACGGTTGCCGCCAGGCCGGATGCGCCCTGGTGGGCGGCGAGACGGCAGAG
ATGCCGGGCATGTACCGGGGCGAGGACTACGACGCCGCCGGCTGCGCCGTCGGCGCCGTCATGGCGTCCCGGCGA
CTCCCGCGCAAGGACGCCATGGTTCGGGGAGACGTGCTCCTGGGCCTGGCGTCCAACGGCGTCCACTCCAACGGC
TTCTCGCTCGTGCGACGCATCGTGCAGCGCGCCGGGCTCGACTACGGCGACAGGGCGCCGTGGGACGAGTCCCAG
ACGGTCGGCCAGGCCCTCCTGACGCCGACGCGCATCTACGTCAAGAGCCTGCTGCCGGTCCTCGACCAGATCAAG
GGCCTGGCGCACATCACGGGCGGCGGCCTGGTCGAGAACGTGCCGCGCATGCTGCCCGAGGGGCTGGCGGCCGAG
ATCGACTTCGGCTCGTGGGACGTGCCGGACGTGTTCCGCTGGCTCAAGACGAGCGGGGCCGTGGCCCCGGCCGAG
ATGTGCCTCACCTTCAACGCGGGCATCGGCATGGTCATCGCCGTGGAGGCGGACAAGGCCGACGCCGTGGCCCGC
GCGCTGGGGGCCTCGGAGAAGGTCTTTCGCCTGGGCAGCCTGGTGCCCCGGGAGCAGGGGCAGCCAGGCTGCGTG
ATCCGGCGGCTGGAATGTTGGGCCTGA
Transcript >Hirsu2|3455
ATGGCCGACCTTCGCGTCCTGCTCATCGGTAGTGGCGGCCGCGAGCACGCCCTGGCCTGGAAGCTAAGCCAGTCG
CCGCGCGTTGCGTCGATTTTCGTAGTGCCCGGCAACGGGGGCACCGCGACCTGTCCCAAGGCGACCAATGTCACG
TCCGTCTCGGCCGACGACTTCGCCGGCCTCGTCGGCTTCTCCCAGGCCAACGGCGTCAACCTGGTGGTACCCGGG
CCCGAGGCGCCGCTCGTGAGCGGTGTCGAGGCCTTCTTCCGGAGGGCCGGCATCCCGTGCTTCGGGCCGTCCAAG
GAGGCGGCCCGGCTGGAGGGCAGCAAGACGTACTCGAAGGACTTCATGAAGAAGTACGGCATCCCCACGGCGGCC
TACGAAAACTTCGCCGACCACGACGGTGCCGTCGCGTACGTCGACCGCGTCGCGCACGACGTCGTCATCAAGGCC
ACCGGCCTGGCCGCCGGCAAGGGCGTCATCATCCCGCGGACCAAGGACGAGGCCAGGGAGGCGCTGAAGCAGATC
ATGGTCGACAGGGCCTTCGGCGCCGCCGGGGACGAGGTCGTCATCGAGGAGCTCCTGGTCGGGGACGAGCTGAGC
GTCCTCAGCTTCTGCGACGGCTACACGATCAAGTCGCTGCCGCTCGCCCAGGACCACAAGAGGATCTTCGACGGG
GACCAGGGCCCCAACACGGGCGGCATGGGCTGCTACGCGCCCACCAACATCGCCACCAAGGACCTGATGGACAGG
ATCAACGGGGAGATCCTCGAGCCCACCATCTCGGGCATGCGCCGCGAGAGGCAACCGTTCCGCGGCGTCCTGTTC
ACCGGCCTCATGATCACCAGCACCGGCCCCAAGGTCTTGGAGTACAACGTCCGGTTCGGGGACCCCGAAACCCAG
ACCGTCCTGCCCCTGCTCTCCGCCGATACCGACCTCGCCGACATCATGCTCGCCTGCGCCGAGGGCTACCTGGAC
AACTGCCGCCTCACGGTCGAGGACAAATTCAGCGCCACCGTCGTGCTGGCCGCCGCCGGCTATCCTGGCTCCTAC
CCCAAGGGGACCCCGATGGCCGTGCGCGCTCCCCCCAGCGGAAGCACAATCTTCCACGCGGGCACCAAGCTCGAG
GGCGATCAGTTGACGACGTCTGGCGGCCGGGTCATCGCCATCACTTCCACCGCCGACTCCCTGCGAGCGGCCGTC
GACTCGTGCTACGCCGCCCTTTCCTCCAAAGTGATAGACTTCGAGGGCATGTTCTACCGGAAGGACATCGCTCAT
CGTGCTTTCAGGGAGCTGGCTCCGGAAGCCATGACGTACGCCCAGGCCGGCGTGGACATCCGGGCCGGGAACGAG
TTCGTGGACAAGATCAAGAAGGCGGTCGCCAGCACCAGGCGTCCCGGCGCCGACGCCGAGATTGGCGGTTTCGGC
GGCGAACTCGACCTCTCGCAGTGCGGGTATCCGGGCGCCCCCGTCCTGGTCGGCGCCATCGACGGCGTCGGAACG
AAGCTGATGATTGCGCAGTCGGTGCGACGTCACGACACGGTGGGCATCGACCTGGTGGCCATGAACGTCAACGAC
CTGATTGTGCAGGGGGCGACGCCGCTCATGTTCCTAGACTACTACGGCTGCAGCAAACTGGACCTGCCCTCGGCG
GCTTCCTTCGTCGAGGGCGTCGCCGACGGTTGCCGCCAGGCCGGATGCGCCCTGGTGGGCGGCGAGACGGCAGAG
ATGCCGGGCATGTACCGGGGCGAGGACTACGACGCCGCCGGCTGCGCCGTCGGCGCCGTCATGGCGTCCCGGCGA
CTCCCGCGCAAGGACGCCATGGTTCGGGGAGACGTGCTCCTGGGCCTGGCGTCCAACGGCGTCCACTCCAACGGC
TTCTCGCTCGTGCGACGCATCGTGCAGCGCGCCGGGCTCGACTACGGCGACAGGGCGCCGTGGGACGAGTCCCAG
ACGGTCGGCCAGGCCCTCCTGACGCCGACGCGCATCTACGTCAAGAGCCTGCTGCCGGTCCTCGACCAGATCAAG
GGCCTGGCGCACATCACGGGCGGCGGCCTGGTCGAGAACGTGCCGCGCATGCTGCCCGAGGGGCTGGCGGCCGAG
ATCGACTTCGGCTCGTGGGACGTGCCGGACGTGTTCCGCTGGCTCAAGACGAGCGGGGCCGTGGCCCCGGCCGAG
ATGTGCCTCACCTTCAACGCGGGCATCGGCATGGTCATCGCCGTGGAGGCGGACAAGGCCGACGCCGTGGCCCGC
GCGCTGGGGGCCTCGGAGAAGGTCTTTCGCCTGGGCAGCCTGGTGCCCCGGGAGCAGGGGCAGCCAGGCTGCGTG
ATCCGGCGGCTGGAATGTTGGGCCTGA
Gene >Hirsu2|3455
ATGGCCGACCTTCGCGTCCTGCTCATCGGTAGTGGCGGCCGCGAGCACGCCCTGGCCTGGAAGCTAAGCCAGTCG
CCGCGCGTTGCGTCGATTTTCGTAGTGCCCGGCAACGGGGGCACCGCGACCTGTCCCAAGGCGACCAATGTCACG
TCCGTCTCGGCCGACGACTTCGCCGGCCTCGTCGGCTTCTCCCAGGCCAACGGCGTCAACCTGGTGGTACCCGGG
CCCGAGGCGCCGCTCGTGAGCGGTGTCGAGGCCTTCTTCCGGAGGGCCGGCATCCCGTGCTTCGGGCCGTCCAAG
GAGGCGGCCCGGCTGGAGGGCAGCAAGACGTACTCGAAGGACTTCATGAAGAAGTACGGCATCCCCACGGCGGCC
TACGAAAACTTCGCCGACCACGACGGTGCCGTCGCGTACGTCGACCGCGTCGCGCACGACGTCGTCATCAAGGCC
ACCGGCCTGGCCGCCGGCAAGGGCGTCATCATCCCGCGGACCAAGGACGAGGCCAGGGAGGCGCTGAAGCAGATC
ATGGTCGACAGGGCCTTCGGCGCCGCCGGGGACGAGGTCGTCATCGAGGAGCTCCTGGTCGGGGACGAGCTGAGC
GTCCTCAGCTTCTGCGACGGCTACACGATCAAGTCGCTGCCGCTCGCCCAGGACCACAAGAGGATCTTCGACGGG
GACCAGGGCCCCAACACGGGCGGCATGGGCTGCTACGCGCCCACCAACATCGCCACCAAGGACCTGATGGACAGG
ATCAACGGGGAGATCCTCGAGCCCACCATCTCGGGCATGCGCCGCGAGAGGCAACCGTTCCGCGGCGTCCTGTTC
ACCGGCCTCATGATCACCAGCACCGGCCCCAAGGTCTTGGAGTACAACGTCCGGTTCGGGGACCCCGAAACCCAG
ACCGTCCTGCCCCTGCTCTCCGCCGATACCGACCTCGCCGACATCATGCTCGCCTGCGCCGAGGGCTACCTGGAC
AACTGCCGCCTCACGGTCGAGGACAAATTCAGCGCCACCGTCGTGCTGGCCGCCGCCGGCTATCCTGGCTCCTAC
CCCAAGGGGACCCCGATGGCCGTGCGCGCTCCCCCCAGCGGAAGCACAATCTTCCACGCGGGCACCAAGCTCGAG
GGCGATCAGTTGACGACGTCTGGCGGCCGGGTCATCGCCATCACTTCCACCGCCGACTCCCTGCGAGCGGCCGTC
GACTCGTGCTACGCCGCCCTTTCCTCCAAAGTGATAGACTTCGAGGGCATGTTCTACCGGAAGGACATCGCTCAT
CGTGCTTTCAGGGAGCTGGCTCCGGAAGCCATGACGTACGCCCAGGCCGGCGTGGACATCCGGGCCGGGAACGAG
TTCGTGGACAAGATCAAGAAGGCGGTCGCCAGCACCAGGCGTCCCGGCGCCGACGCCGAGATTGGCGGTTTCGGC
GGCGAACTCGACCTCTCGCAGTGCGGGTATCCGGGCGCCCCCGTCCTGGTCGGCGCCATCGACGGCGTCGGAACG
AAGCTGATGATTGCGCAGTCGGTGCGACGTCACGACACGGTGGGCATCGACCTGGTGGCCATGAACGTCAACGAC
CTGATTGTGCAGGGGGCGACGCCGCTCATGTTCCTAGACTACTACGGCTGCAGCAAACTGGACCTGCCCTCGGCG
GCTTCCTTCGTCGAGGGCGTCGCCGACGGTTGCCGCCAGGCCGGATGCGCCCTGGTGGGCGGCGAGACGGCAGAG
ATGCCGGGCATGTACCGGGGCGAGGACTACGACGCCGCCGGCTGCGCCGTCGGCGCCGTCATGGCGTCCCGGCGA
CTCCCGCGCAAGGACGCCATGGTTCGGGGAGACGTGCTCCTGGGCCTGGCGTCCAACGGCGTCCACTCCAACGGC
TTCTCGCTCGTGCGACGCATCGTGCAGCGCGCCGGGCTCGACTACGGCGACAGGGCGCCGTGGGACGAGTCCCAG
ACGGTCGGCCAGGCCCTCCTGACGCCGACGCGCATCTACGTCAAGAGCCTGCTGCCGGTCCTCGACCAGATCAAG
GGCCTGGCGCACATCACGGGCGGCGGCCTGGTCGAGAACGTGCCGCGCATGCTGCCCGAGGGGCTGGCGGCCGAG
ATCGACTTCGGCTCGTGGGACGTGCCGGACGTGTTCCGCTGGCTCAAGACGAGCGGGGCCGTGGCCCCGGCCGAG
ATGTGCCTCACCTTCAACGCGGGCATCGGCATGGTCATCGCCGTGGAGGCGGACAAGGCCGACGCCGTGGCCCGC
GCGCTGGGGGCCTCGGAGAAGGTCTTTCGCCTGGGCAGCCTGGTGCCCCGGGAGCAGGGGCAGCCAGGCTGCGTG
ATCCGGCGGCTGGAATGTTGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail