Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|345
Gene name
LocationContig_1066:6933..8004
Strand+
Gene length (bp)1071
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain 8.4E-57 14 137
PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain 1.7E-48 140 267
PF04139 Rad9 Rad9 1.6E-07 26 230
PF02144 Rad1 Repair protein Rad1/Rec1/Rad17 2.7E-05 15 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03392|PCNA_SCHPO Proliferating cell nuclear antigen OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcn1 PE=1 SV=1 14 272 2.0E-127
sp|Q43266|PCNA_MAIZE Proliferating cell nuclear antigen OS=Zea mays GN=PCNA PE=2 SV=1 14 272 3.0E-106
sp|O82797|PCNA_TOBAC Proliferating cell nuclear antigen OS=Nicotiana tabacum GN=PCNA PE=2 SV=1 14 272 2.0E-105
sp|Q00268|PCNA1_DAUCA Proliferating cell nuclear antigen OS=Daucus carota PE=3 SV=1 14 272 4.0E-105
sp|O82134|PCNA_PEA Proliferating cell nuclear antigen OS=Pisum sativum GN=PCNA PE=2 SV=1 14 272 9.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03392|PCNA_SCHPO Proliferating cell nuclear antigen OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcn1 PE=1 SV=1 14 272 2.0E-127
sp|Q43266|PCNA_MAIZE Proliferating cell nuclear antigen OS=Zea mays GN=PCNA PE=2 SV=1 14 272 3.0E-106
sp|O82797|PCNA_TOBAC Proliferating cell nuclear antigen OS=Nicotiana tabacum GN=PCNA PE=2 SV=1 14 272 2.0E-105
sp|Q00268|PCNA1_DAUCA Proliferating cell nuclear antigen OS=Daucus carota PE=3 SV=1 14 272 4.0E-105
sp|O82134|PCNA_PEA Proliferating cell nuclear antigen OS=Pisum sativum GN=PCNA PE=2 SV=1 14 272 9.0E-105
sp|P17070|PCNA_ORYSJ Proliferating cell nuclear antigen OS=Oryza sativa subsp. japonica GN=Os02g0805200 PE=2 SV=2 14 272 9.0E-105
sp|P24314|PCNA_CATRO Proliferating cell nuclear antigen OS=Catharanthus roseus PE=2 SV=1 14 272 3.0E-103
sp|Q9ZW35|PCNA2_ARATH Proliferating cell nuclear antigen 2 OS=Arabidopsis thaliana GN=PCNA2 PE=1 SV=1 14 272 7.0E-103
sp|Q43124|PCNA_BRANA Proliferating cell nuclear antigen OS=Brassica napus PE=2 SV=1 14 272 1.0E-102
sp|Q00265|PCNA2_DAUCA Proliferating cell nuclear antigen large form OS=Daucus carota PE=2 SV=1 14 268 4.0E-102
sp|Q9M7Q7|PCNA1_ARATH Proliferating cellular nuclear antigen 1 OS=Arabidopsis thaliana GN=PCNA PE=1 SV=2 14 272 7.0E-102
sp|Q9MAY3|PCNA_POPNI Proliferating cell nuclear antigen OS=Populus nigra GN=PCNA PE=2 SV=1 14 272 2.0E-101
sp|P17917|PCNA_DROME Proliferating cell nuclear antigen OS=Drosophila melanogaster GN=PCNA PE=1 SV=2 14 272 2.0E-99
sp|P61258|PCNA_MACFA Proliferating cell nuclear antigen OS=Macaca fascicularis GN=PCNA PE=2 SV=1 14 272 4.0E-97
sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1 14 272 4.0E-97
sp|O16852|PCNA_SARCR Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis GN=PCNA PE=3 SV=1 14 272 1.0E-96
sp|P57761|PCNA_CRIGR Proliferating cell nuclear antigen OS=Cricetulus griseus GN=PCNA PE=1 SV=1 14 272 2.0E-96
sp|Q3ZBW4|PCNA_BOVIN Proliferating cell nuclear antigen OS=Bos taurus GN=PCNA PE=2 SV=1 14 272 3.0E-96
sp|Q9DEA3|PCNA_CHICK Proliferating cell nuclear antigen OS=Gallus gallus GN=PCNA PE=1 SV=1 14 272 5.0E-96
sp|P04961|PCNA_RAT Proliferating cell nuclear antigen OS=Rattus norvegicus GN=Pcna PE=1 SV=1 14 272 9.0E-96
sp|O01377|PCNA_BOMMO Proliferating cell nuclear antigen OS=Bombyx mori GN=PCNA PE=2 SV=1 14 272 2.0E-95
sp|Q9DDF1|PCNA_COTJA Proliferating cell nuclear antigen OS=Coturnix coturnix japonica GN=PCNA PE=2 SV=1 14 272 3.0E-95
sp|P17918|PCNA_MOUSE Proliferating cell nuclear antigen OS=Mus musculus GN=Pcna PE=1 SV=2 14 272 3.0E-95
sp|Q9PTP1|PCNA_DANRE Proliferating cell nuclear antigen OS=Danio rerio GN=pcna PE=1 SV=2 14 271 1.0E-92
sp|Q6B6N4|PCNA_HAPBU Proliferating cell nuclear antigen OS=Haplochromis burtoni GN=pcna PE=2 SV=1 14 271 2.0E-92
sp|P53358|PCNA_STYCL Proliferating cell nuclear antigen OS=Styela clava GN=PCNA PE=2 SV=1 14 272 4.0E-92
sp|P18248|PCNA_XENLA Proliferating cell nuclear antigen OS=Xenopus laevis GN=pcna PE=2 SV=1 14 272 4.0E-92
sp|Q9W644|PCNA_ANGJA Proliferating cell nuclear antigen OS=Anguilla japonica GN=pcna PE=2 SV=1 14 271 5.0E-90
sp|P22177|PCNA_SOYBN Proliferating cell nuclear antigen (Fragment) OS=Glycine max PE=2 SV=1 46 272 2.0E-89
sp|P15873|PCNA_YEAST Proliferating cell nuclear antigen OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL30 PE=1 SV=1 14 272 2.0E-84
sp|Q54K47|PCNA_DICDI Proliferating cell nuclear antigen OS=Dictyostelium discoideum GN=pcna PE=3 SV=1 14 268 9.0E-79
sp|O02115|PCNA_CAEEL Proliferating cell nuclear antigen OS=Caenorhabditis elegans GN=pcn-1 PE=1 SV=3 14 272 5.0E-78
sp|P11038|PCNA_NPVAC Probable DNA polymerase sliding clamp OS=Autographa californica nuclear polyhedrosis virus GN=PCNA PE=2 SV=1 14 272 2.0E-60
sp|P31008|PCNA_PLAFK Proliferating cell nuclear antigen OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PCNA PE=3 SV=1 14 266 7.0E-49
sp|P61074|PCNA_PLAF7 Proliferating cell nuclear antigen OS=Plasmodium falciparum (isolate 3D7) GN=PCNA PE=3 SV=1 14 266 7.0E-49
sp|Q84513|PCNA1_PBCV1 Probable DNA polymerase sliding clamp 1 OS=Paramecium bursaria Chlorella virus 1 GN=A193L PE=3 SV=1 14 266 2.0E-39
sp|O10308|PCNA_NPVOP Probable DNA polymerase sliding clamp OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=PCNA PE=3 SV=1 26 268 7.0E-33
sp|Q57697|PCNA_METJA DNA polymerase sliding clamp OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pcn PE=3 SV=1 14 268 2.0E-32
sp|A6UQZ4|PCNA_METVS DNA polymerase sliding clamp OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pcn PE=3 SV=1 25 268 4.0E-32
sp|A9A8V2|PCNA_METM6 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pcn PE=3 SV=1 25 268 1.0E-27
sp|A4G0K8|PCNA_METM5 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pcn PE=3 SV=1 25 268 2.0E-27
sp|Q6LWJ8|PCNA_METMP DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain S2 / LL) GN=pcn PE=3 SV=1 25 268 2.0E-27
sp|A6VHX7|PCNA_METM7 DNA polymerase sliding clamp OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pcn PE=3 SV=1 25 268 3.0E-27
sp|A0RXH7|PCNA_CENSY DNA polymerase sliding clamp OS=Cenarchaeum symbiosum (strain A) GN=pcn PE=3 SV=1 15 268 3.0E-27
sp|A5UMB4|PCNA_METS3 DNA polymerase sliding clamp OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pcn PE=3 SV=1 14 272 2.0E-24
sp|A9A2X4|PCNA_NITMS DNA polymerase sliding clamp OS=Nitrosopumilus maritimus (strain SCM1) GN=pcn PE=3 SV=1 17 268 2.0E-24
sp|A6UUW0|PCNA_META3 DNA polymerase sliding clamp OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pcn PE=3 SV=1 14 268 2.0E-24
sp|O41056|PCNA2_PBCV1 Probable DNA polymerase sliding clamp 2 OS=Paramecium bursaria Chlorella virus 1 GN=A574L PE=3 SV=1 13 271 4.0E-24
sp|O27367|PCNA_METTH DNA polymerase sliding clamp OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pcn PE=3 SV=1 14 272 5.0E-23
sp|O58398|PCNA_PYRHO DNA polymerase sliding clamp OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pcn PE=3 SV=1 15 268 6.0E-21
sp|Q9UYX8|PCNA_PYRAB DNA polymerase sliding clamp OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pcn PE=1 SV=1 15 268 1.0E-20
sp|O73947|PCNA_PYRFU DNA polymerase sliding clamp OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pcn PE=1 SV=2 15 268 1.0E-19
sp|Q8ZTY0|PCNA1_PYRAE DNA polymerase sliding clamp 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pcn1 PE=3 SV=1 28 268 1.0E-19
sp|A0B7Y8|PCNA_METTP DNA polymerase sliding clamp OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pcn PE=3 SV=1 14 268 3.0E-19
sp|P57762|PCNA1_SULOH DNA polymerase sliding clamp 1 OS=Sulfurisphaera ohwakuensis GN=pcn1 PE=3 SV=1 25 268 7.0E-19
sp|Q9UWR9|PCNA_THEFM DNA polymerase sliding clamp OS=Thermococcus fumicolans GN=pcn PE=3 SV=1 35 270 2.0E-18
sp|Q8TWK3|PCNA_METKA DNA polymerase sliding clamp OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pcn PE=3 SV=1 14 268 2.0E-18
sp|Q2NE55|PCNA_METST DNA polymerase sliding clamp OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pcn PE=3 SV=1 14 247 1.0E-17
sp|A1RXU8|PCNA_THEPD DNA polymerase sliding clamp OS=Thermofilum pendens (strain Hrk 5) GN=pcn PE=3 SV=1 14 268 3.0E-17
sp|Q975N2|PCNA1_SULTO DNA polymerase sliding clamp 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn1 PE=1 SV=1 25 268 3.0E-17
sp|C5A5N6|PCNA_THEGJ DNA polymerase sliding clamp OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pcn PE=3 SV=1 35 268 4.0E-17
sp|B9LU30|PCNA_HALLT DNA polymerase sliding clamp OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pcn PE=3 SV=1 22 271 8.0E-17
sp|Q74MV1|PCNA_NANEQ DNA polymerase sliding clamp OS=Nanoarchaeum equitans (strain Kin4-M) GN=pcn PE=3 SV=2 22 267 2.0E-16
sp|P57765|PCNA3_SULSO DNA polymerase sliding clamp 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pcn3 PE=1 SV=1 24 268 2.0E-16
sp|Q5JF32|PCNA1_THEKO DNA polymerase sliding clamp 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pcn1 PE=1 SV=1 35 268 2.0E-16
sp|Q4JAI6|PCNA1_SULAC DNA polymerase sliding clamp 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pcn1 PE=3 SV=2 25 268 2.0E-16
sp|Q3IU15|PCNA_NATPD DNA polymerase sliding clamp OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pcn PE=3 SV=1 22 271 3.0E-16
sp|O29912|PCNA_ARCFU DNA polymerase sliding clamp OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcn PE=1 SV=1 22 268 8.0E-16
sp|Q18E60|PCNA_HALWD DNA polymerase sliding clamp OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pcn PE=3 SV=1 22 271 2.0E-15
sp|Q9HN45|PCNA_HALSA DNA polymerase sliding clamp OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pcn PE=3 SV=1 22 268 4.0E-15
sp|B0R7F7|PCNA_HALS3 DNA polymerase sliding clamp OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pcn PE=3 SV=1 22 268 4.0E-15
sp|Q9YEZ5|PCNA3_AERPE DNA polymerase sliding clamp 3 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcn3 PE=3 SV=2 14 268 8.0E-15
sp|Q46E39|PCNA_METBF DNA polymerase sliding clamp OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pcn PE=3 SV=1 21 271 1.0E-14
sp|Q9P9H8|PCNA_HALMA DNA polymerase sliding clamp OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pcn PE=3 SV=2 22 268 2.0E-14
sp|B6YVZ1|PCNA_THEON DNA polymerase sliding clamp OS=Thermococcus onnurineus (strain NA1) GN=pcn PE=3 SV=1 35 270 3.0E-14
sp|Q973F5|PCNA3_SULTO DNA polymerase sliding clamp 3 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn3 PE=1 SV=1 15 267 6.0E-14
sp|Q8PX25|PCNA_METMA DNA polymerase sliding clamp OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pcn PE=3 SV=1 21 271 1.0E-13
sp|Q5JFD3|PCNA2_THEKO DNA polymerase sliding clamp 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pcn2 PE=1 SV=1 15 268 2.0E-13
sp|Q7T6Y0|PCNA_MIMIV Probable DNA polymerase sliding clamp OS=Acanthamoeba polyphaga mimivirus GN=PCNA PE=3 SV=2 12 266 2.0E-13
sp|A2SSW6|PCNA_METLZ DNA polymerase sliding clamp OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pcn PE=3 SV=1 14 271 4.0E-13
sp|Q8TUF7|PCNA_METAC DNA polymerase sliding clamp OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcn PE=3 SV=1 21 271 7.0E-13
sp|Q12U18|PCNA_METBU DNA polymerase sliding clamp OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pcn PE=3 SV=1 14 271 3.0E-12
sp|Q9YFT8|PCNA1_AERPE DNA polymerase sliding clamp 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcn1 PE=3 SV=2 21 269 6.0E-12
sp|A7I849|PCNA_METB6 DNA polymerase sliding clamp OS=Methanoregula boonei (strain 6A8) GN=pcn PE=3 SV=1 14 271 1.0E-11
sp|C6A1Y5|PCNA_THESM DNA polymerase sliding clamp OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pcn PE=3 SV=1 28 268 5.0E-11
sp|Q97Z84|PCNA2_SULSO DNA polymerase sliding clamp 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pcn2 PE=1 SV=2 15 267 1.0E-10
sp|Q979S2|PCNA_THEVO DNA polymerase sliding clamp OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pcn PE=3 SV=2 25 268 2.0E-10
sp|Q6KZF1|PCNA_PICTO DNA polymerase sliding clamp OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pcn PE=3 SV=1 25 268 3.0E-10
sp|Q9HJQ0|PCNA_THEAC DNA polymerase sliding clamp OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pcn PE=3 SV=1 25 268 3.0E-10
sp|B8GG80|PCNA_METPE DNA polymerase sliding clamp OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pcn PE=3 SV=1 14 268 5.0E-10
sp|Q4J9A8|PCNA2_SULAC DNA polymerase sliding clamp 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pcn2 PE=3 SV=1 27 267 3.0E-09
sp|Q5UQH4|YL823_MIMIV Uncharacterized protein L823 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L823 PE=3 SV=1 10 250 4.0E-09
sp|Q2FNX1|PCNA_METHJ DNA polymerase sliding clamp OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pcn PE=3 SV=1 14 271 1.0E-08
sp|A3CVJ2|PCNA_METMJ DNA polymerase sliding clamp OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pcn PE=3 SV=1 14 268 5.0E-08
sp|Q8ZYL6|PCNA2_PYRAE DNA polymerase sliding clamp 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pcn2 PE=3 SV=1 39 268 4.0E-07
sp|Q975M2|PCNA2_SULTO DNA polymerase sliding clamp 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pcn2 PE=1 SV=1 14 268 7.0E-07
sp|P57763|PCNA2_SULOH DNA polymerase sliding clamp 2 OS=Sulfurisphaera ohwakuensis GN=pcn2 PE=3 SV=1 14 268 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030896 checkpoint clamp complex Yes
GO:0003677 DNA binding Yes
GO:0000077 DNA damage checkpoint Yes
GO:0006275 regulation of DNA replication Yes
GO:0005634 nucleus Yes
GO:0065007 biological regulation No
GO:0043229 intracellular organelle No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0003676 nucleic acid binding No
GO:0019222 regulation of metabolic process No
GO:0044428 nuclear part No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0050896 response to stimulus No
GO:0048523 negative regulation of cellular process No
GO:0000075 cell cycle checkpoint No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051052 regulation of DNA metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0044446 intracellular organelle part No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044427 chromosomal part No
GO:0045786 negative regulation of cell cycle No
GO:0044454 nuclear chromosome part No
GO:0031323 regulation of cellular metabolic process No
GO:0051726 regulation of cell cycle No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0048519 negative regulation of biological process No
GO:0031570 DNA integrity checkpoint No
GO:0033554 cellular response to stress No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|345
LSHTVLPKEQASKMLEARLEQANILKKVVDAIKELVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRC
DRNIALGVNLTSLTKVLRAAQNEDILTLKADDAPDVLNLVFESSENDRISEYDLKLMDIDQEHLGIPETEYAATI
AMPAAEFRRICTDLAAMSESVNIEASKDGVKFSCNGDIGMGSVTLRSHTNVEKPELNVDIELSEPVCLTFSLKYL
VNFCKAASLSSQVKICLSSEVPLLVEYNLSGSSFLRFYLAPKIGDDE*
Coding >Hirsu2|345
CTGTCTCACACAGTTCTCCCAAAGGAGCAAGCCAGCAAGATGTTGGAAGCACGGCTCGAGCAGGCCAATATCCTT
AAGAAGGTGGTGGATGCCATCAAGGAGCTCGTCCAGGACTGCAACTTCGACTGCAATGACTCGGGCATCGCGCTG
CAGGCCATGGACAACTCGCACGTGGCGCTGGTGTCGATGATGCTCAAGGCCGAGGGCTTCTCGCCCTACCGCTGC
GACCGCAACATCGCGCTCGGCGTCAACCTGACGTCCCTGACCAAGGTGCTCCGCGCGGCCCAGAACGAGGACATC
CTGACGCTCAAGGCCGACGACGCGCCCGACGTGCTGAACCTGGTCTTTGAGAGCAGCGAAAACGACCGGATCAGC
GAGTACGACCTCAAGCTCATGGACATTGACCAGGAGCACCTGGGCATCCCCGAGACGGAGTACGCGGCCACGATC
GCCATGCCGGCCGCCGAGTTTCGGAGGATCTGCACAGACCTGGCTGCCATGTCGGAATCAGTCAACATCGAGGCA
TCCAAGGACGGTGTCAAGTTCTCGTGCAACGGCGACATCGGCATGGGCTCCGTCACGCTGCGCAGCCACACCAAC
GTCGAGAAGCCGGAGCTCAACGTCGACATTGAGCTGTCGGAGCCCGTCTGCCTGACCTTCTCCCTCAAGTACCTC
GTCAACTTCTGCAAGGCCGCCAGCCTGTCCAGCCAGGTCAAGATCTGCCTGTCGAGCGAGGTGCCGCTGCTGGTC
GAGTACAACCTGTCGGGCAGCAGCTTTCTGCGCTTCTACCTGGCGCCAAAGATTGGCGACGACGAGTAA
Transcript >Hirsu2|345
CTGTCTCACACAGTTCTCCCAAAGGAGCAAGCCAGCAAGATGTTGGAAGCACGGCTCGAGCAGGCCAATATCCTT
AAGAAGGTGGTGGATGCCATCAAGGAGCTCGTCCAGGACTGCAACTTCGACTGCAATGACTCGGGCATCGCGCTG
CAGGCCATGGACAACTCGCACGTGGCGCTGGTGTCGATGATGCTCAAGGCCGAGGGCTTCTCGCCCTACCGCTGC
GACCGCAACATCGCGCTCGGCGTCAACCTGACGTCCCTGACCAAGGTGCTCCGCGCGGCCCAGAACGAGGACATC
CTGACGCTCAAGGCCGACGACGCGCCCGACGTGCTGAACCTGGTCTTTGAGAGCAGCGAAAACGACCGGATCAGC
GAGTACGACCTCAAGCTCATGGACATTGACCAGGAGCACCTGGGCATCCCCGAGACGGAGTACGCGGCCACGATC
GCCATGCCGGCCGCCGAGTTTCGGAGGATCTGCACAGACCTGGCTGCCATGTCGGAATCAGTCAACATCGAGGCA
TCCAAGGACGGTGTCAAGTTCTCGTGCAACGGCGACATCGGCATGGGCTCCGTCACGCTGCGCAGCCACACCAAC
GTCGAGAAGCCGGAGCTCAACGTCGACATTGAGCTGTCGGAGCCCGTCTGCCTGACCTTCTCCCTCAAGTACCTC
GTCAACTTCTGCAAGGCCGCCAGCCTGTCCAGCCAGGTCAAGATCTGCCTGTCGAGCGAGGTGCCGCTGCTGGTC
GAGTACAACCTGTCGGGCAGCAGCTTTCTGCGCTTCTACCTGGCGCCAAAGATTGGCGACGACGAGTAA
Gene >Hirsu2|345
CTGTCTCACACAGTTCTCCCAAAGGAGCAAGCCAGCAGTACGTCCATCCTTGCCTGCGCCTCTGCCCGAGACGGG
CGCGGCTCGTCGTCCAGTCTAACGCAAGGCCGCAGAGATGTTGGAAGCACGGCTCGAGCAGGCCAATATCCTTAA
GAAGGTACGCCCCGCCGACCGCTGCGGGCGCGAGACGAGACGCTGACGCGGTGCAGGTGGTGGATGCCATCAAGG
AGCTCGTCCAGGACTGCAACTTCGACTGCAATGACTCGGGCATCGCGCTGCAGGCCATGGACAACTCGCACGTGG
CGCTGGTGTCGATGATGCTCAAGGCCGAGGGCTTCTCGCCCTACCGCTGCGACCGCAACATCGCGCTCGGCGTCA
ACCTGACGTCCCTGACCAAGGTGCTCCGCGCGGCCCAGAACGAGGACATCCTGACGCTCAAGGCCGACGACGCGC
CCGACGTGCTGAACCTGGTCTTTGAGAGCAGCGAAAACGACCGGATCAGCGAGTACGACCTCAAGCTCATGGACA
TTGACCAGGAGCACCTGGGCATCCCCGAGACGGAGTACGCGGCCACGATCGCCATGCCGGCCGCCGAGTTTCGGA
GGATCTGCACAGACCTGGCTGCCATGTCGGAATCAGGTGCGTCGAGCTCTCCTCGCCCCGTGAAGGCGGCCTTGC
TGACATGTGACGTCGCCGGCCTGCAGTCAACATCGAGGCATCCAAGGACGGTGTCAAGTTCTCGTGCAACGGCGA
CATCGGCATGGGCTCCGTCACGCTGCGCAGCCACACCAACGTCGAGAAGCCGGAGCTCAACGTCGACATTGAGCT
GTCGGAGCCCGTCTGCCTGACCTTCTCCCTCAAGTACCTCGTCAACTTCTGCAAGGCCGCCAGCCTGTCCAGCCA
GGTCAAGATCTGCCTGTCGAGCGAGGTGCCGCTGCTGGTCGAGTACAACCTGTCGGGCAGCAGCTTTCTGCGCTT
CTACCTGGCGCCAAAGGTGCGCTGCCGACTCCCCCGTTTTGCATTTGCTTGTGCCAACTGACGCTCGAACCTGCA
CAGATTGGCGACGACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail