Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3448
Gene name
LocationContig_190:745..2833
Strand-
Gene length (bp)2088
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 Uncharacterised ACR, YagE family COG1723 2.5E-54 315 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 96 521 1.0E-86
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 313 553 3.0E-84
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 89 541 4.0E-51
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 312 541 8.0E-46
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 5 260 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 96 521 1.0E-86
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 313 553 3.0E-84
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 89 541 4.0E-51
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 312 541 8.0E-46
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 5 260 3.0E-27
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 315 541 7.0E-20
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 315 541 3.0E-19
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 315 541 3.0E-18
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 315 530 4.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 521 543 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3448
MSSGKQRPSVLVTDSRERTNQRKAPRRQDTSSAAAGRTPMRFMTVDNVLQYNSQIPSGQPRGPPIPTQRPHPPAL
TGRRVSAGGLPNVQSRTGQSIPSRTTKISEKLVLLPETDQDGEDAEEEVESESVLSRRLQEEQSRPLKDEELDVL
KKRGGIRGKSFAERLPKLQRKDRVSRLTAYCTAQAFKIRATSEFLRAKHEAKTKLYDDCLYVIYALPLLNGTDGY
RVRGRPMLKTPGTGKTMLDLEIERSERRDHHEGYFEDDAYTTPESFEGAGRGVASFGDPSPDDETQRDNEDGIPS
QINRLAPDAKNFAEMFVFSYGVVVFWNFTEHQEKDILADLTFADAEDGISLLTRPFEQDNFETEEFHFEYSADVK
RPRVFNDMITLLPRSDHMIKLTISHAIAQSTKLCFFEERMSETMLDAQHVPKTLALTGQLNMTRTEIVKILGRLF
KSRVDINLSSNMLDVPNFFWDSEPTLHPLYVAVREYLEIDPRIKVLNERCRVFLDLAEILSDSVNDAKMSAITWT
VIVLILVSILVTVTEVGLRFVMLSKNSGKAPGAASSAVRWASPAAAAPEVVLVPAPDKQVPLGRQASPGAGAGGL
EELAAALGLRGNASMEDIRQGILDLRRDGSTGRPERAA*
Coding >Hirsu2|3448
ATGTCGTCGGGAAAACAGCGACCGTCGGTGCTTGTCACCGACTCGAGGGAAAGGACAAACCAGAGAAAGGCCCCG
CGGCGCCAGGACACGTCGTCCGCGGCTGCTGGCCGGACGCCTATGCGATTCATGACGGTCGACAACGTGCTTCAA
TACAACTCGCAGATCCCGTCCGGCCAGCCGCGAGGGCCGCCGATACCGACCCAGAGGCCGCATCCACCGGCCCTG
ACCGGCAGGCGTGTGTCGGCCGGCGGCCTGCCCAACGTCCAGTCGCGCACGGGACAGTCGATACCGTCGAGGACG
ACGAAAATCAGCGAAAAGCTAGTGCTGCTGCCCGAGACGGATCAAGACGGCGAGGATGCCGAGGAGGAGGTCGAG
AGCGAGTCTGTCCTCTCCAGGAGGCTACAGGAGGAGCAGAGTCGACCGTTGAAGGACGAGGAGCTGGATGTGCTC
AAAAAGAGAGGCGGTATCCGGGGCAAGAGCTTCGCCGAGAGATTGCCCAAGCTGCAGAGGAAGGACAGGGTGAGC
CGGCTGACGGCCTACTGCACGGCTCAAGCCTTCAAGATCCGCGCCACGTCGGAATTCTTGCGGGCCAAGCACGAG
GCCAAGACGAAGCTCTACGACGACTGCCTCTACGTCATCTACGCCCTGCCCCTGCTCAACGGCACGGACGGCTAC
CGCGTCCGCGGGCGGCCCATGCTCAAGACGCCGGGGACGGGCAAGACGATGCTTGACCTGGAGATTGAGCGGAGC
GAACGGCGTGACCACCACGAGGGGTACTTTGAAGACGACGCCTACACGACGCCCGAGAGCTTCGAGGGGGCGGGC
CGCGGGGTGGCGTCCTTCGGCGACCCATCGCCCGACGACGAAACGCAGCGAGACAATGAGGACGGGATACCGTCC
CAGATCAACCGGCTGGCCCCCGACGCCAAGAACTTTGCCGAGATGTTCGTCTTCTCGTACGGCGTCGTCGTCTTC
TGGAACTTTACGGAGCACCAAGAAAAGGACATCTTGGCGGACCTCACGTTTGCGGATGCCGAGGACGGCATCAGC
CTGCTGACCAGGCCCTTTGAGCAGGACAACTTCGAGACGGAGGAGTTTCACTTCGAGTACAGCGCCGACGTCAAG
CGGCCGCGCGTCTTCAACGACATGATCACCCTGCTGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCAT
GCCATCGCGCAGAGCACCAAGCTGTGCTTCTTCGAGGAGCGGATGAGCGAGACGATGCTGGACGCGCAGCACGTG
CCCAAGACGCTGGCGCTGACGGGCCAGCTCAACATGACGAGGACGGAGATTGTCAAGATCTTGGGCAGGCTGTTC
AAGAGCCGCGTCGACATCAACCTCTCTTCCAACATGCTCGACGTGCCCAACTTCTTCTGGGACTCGGAGCCGACA
CTGCACCCGCTGTACGTGGCGGTGCGCGAGTATCTGGAGATCGACCCGCGCATCAAGGTGCTCAACGAGCGCTGC
CGCGTGTTCCTCGACCTGGCCGAGATACTGTCGGACTCGGTCAATGACGCCAAGATGAGTGCCATAACATGGACC
GTCATTGTCCTGATCCTCGTCAGCATCCTGGTCACCGTGACCGAGGTCGGGCTGCGATTTGTCATGCTGAGCAAG
AACTCGGGCAAGGCGCCGGGAGCGGCGTCGTCGGCGGTGAGGTGGGCCAGCCCGGCGGCGGCGGCCCCCGAGGTG
GTGCTGGTGCCGGCGCCGGACAAGCAGGTACCGCTCGGGCGACAGGCTTCGCCGGGGGCCGGGGCCGGCGGGCTG
GAGGAGCTCGCGGCGGCGCTCGGGCTGCGGGGCAACGCCAGCATGGAGGACATCAGGCAAGGCATCCTGGATTTG
AGACGAGACGGCTCGACTGGCCGTCCGGAGCGCGCCGCCTAG
Transcript >Hirsu2|3448
ATGTCGTCGGGAAAACAGCGACCGTCGGTGCTTGTCACCGACTCGAGGGAAAGGACAAACCAGAGAAAGGCCCCG
CGGCGCCAGGACACGTCGTCCGCGGCTGCTGGCCGGACGCCTATGCGATTCATGACGGTCGACAACGTGCTTCAA
TACAACTCGCAGATCCCGTCCGGCCAGCCGCGAGGGCCGCCGATACCGACCCAGAGGCCGCATCCACCGGCCCTG
ACCGGCAGGCGTGTGTCGGCCGGCGGCCTGCCCAACGTCCAGTCGCGCACGGGACAGTCGATACCGTCGAGGACG
ACGAAAATCAGCGAAAAGCTAGTGCTGCTGCCCGAGACGGATCAAGACGGCGAGGATGCCGAGGAGGAGGTCGAG
AGCGAGTCTGTCCTCTCCAGGAGGCTACAGGAGGAGCAGAGTCGACCGTTGAAGGACGAGGAGCTGGATGTGCTC
AAAAAGAGAGGCGGTATCCGGGGCAAGAGCTTCGCCGAGAGATTGCCCAAGCTGCAGAGGAAGGACAGGGTGAGC
CGGCTGACGGCCTACTGCACGGCTCAAGCCTTCAAGATCCGCGCCACGTCGGAATTCTTGCGGGCCAAGCACGAG
GCCAAGACGAAGCTCTACGACGACTGCCTCTACGTCATCTACGCCCTGCCCCTGCTCAACGGCACGGACGGCTAC
CGCGTCCGCGGGCGGCCCATGCTCAAGACGCCGGGGACGGGCAAGACGATGCTTGACCTGGAGATTGAGCGGAGC
GAACGGCGTGACCACCACGAGGGGTACTTTGAAGACGACGCCTACACGACGCCCGAGAGCTTCGAGGGGGCGGGC
CGCGGGGTGGCGTCCTTCGGCGACCCATCGCCCGACGACGAAACGCAGCGAGACAATGAGGACGGGATACCGTCC
CAGATCAACCGGCTGGCCCCCGACGCCAAGAACTTTGCCGAGATGTTCGTCTTCTCGTACGGCGTCGTCGTCTTC
TGGAACTTTACGGAGCACCAAGAAAAGGACATCTTGGCGGACCTCACGTTTGCGGATGCCGAGGACGGCATCAGC
CTGCTGACCAGGCCCTTTGAGCAGGACAACTTCGAGACGGAGGAGTTTCACTTCGAGTACAGCGCCGACGTCAAG
CGGCCGCGCGTCTTCAACGACATGATCACCCTGCTGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCAT
GCCATCGCGCAGAGCACCAAGCTGTGCTTCTTCGAGGAGCGGATGAGCGAGACGATGCTGGACGCGCAGCACGTG
CCCAAGACGCTGGCGCTGACGGGCCAGCTCAACATGACGAGGACGGAGATTGTCAAGATCTTGGGCAGGCTGTTC
AAGAGCCGCGTCGACATCAACCTCTCTTCCAACATGCTCGACGTGCCCAACTTCTTCTGGGACTCGGAGCCGACA
CTGCACCCGCTGTACGTGGCGGTGCGCGAGTATCTGGAGATCGACCCGCGCATCAAGGTGCTCAACGAGCGCTGC
CGCGTGTTCCTCGACCTGGCCGAGATACTGTCGGACTCGGTCAATGACGCCAAGATGAGTGCCATAACATGGACC
GTCATTGTCCTGATCCTCGTCAGCATCCTGGTCACCGTGACCGAGGTCGGGCTGCGATTTGTCATGCTGAGCAAG
AACTCGGGCAAGGCGCCGGGAGCGGCGTCGTCGGCGGTGAGGTGGGCCAGCCCGGCGGCGGCGGCCCCCGAGGTG
GTGCTGGTGCCGGCGCCGGACAAGCAGGTACCGCTCGGGCGACAGGCTTCGCCGGGGGCCGGGGCCGGCGGGCTG
GAGGAGCTCGCGGCGGCGCTCGGGCTGCGGGGCAACGCCAGCATGGAGGACATCAGGCAAGGCATCCTGGATTTG
AGACGAGACGGCTCGACTGGCCGTCCGGAGCGCGCCGCCTAG
Gene >Hirsu2|3448
ATGTCGTCGGGAAAACAGCGACCGTCGGTGCTTGTACGGCTCCCCAGGCCCCAATGCTGTCGCAGCTTGCTCAGT
CGCTAACGCAGGCGCGCATAGGTCACCGACTCGAGGGAAAGGACAAACCAGAGAAAGGCCCCGCGGCGCCAGGAC
ACGTCGTCCGCGGCTGCTGGCCGGACGCCTATGCGATTCATGACGGTCGACAACGTGCTTCAATACAACTCGCAG
ATCCCGTCCGGCCAGCCGCGAGGGCCGCCGATACCGACCCAGAGGCCGCATCCACCGGCCCTGACCGGCAGGCGT
GTGTCGGCCGGCGGCCTGCCCAACGTCCAGTCGCGCACGGGACAGTCGATACCGTCGAGGACGACGAAAATCAGC
GAAAAGCTAGTGCTGCTGCCCGAGACGGATCAAGACGGCGAGGATGCCGAGGAGGAGGTCGAGAGCGAGTCTGTC
CTCTCCAGGAGGCTACAGGAGGAGCAGAGTCGACCGTTGAAGGACGAGGAGCTGGATGTGCTCAAAAAGAGAGGC
GGTATCCGGGGCAAGAGCTTCGCCGAGAGATTGCCCAAGCTGCAGAGGAAGGACAGGGTGAGCCGGCTGACGGCC
TACTGCACGGCTCAAGCCTTCAAGATCCGCGCCACGTCGGAATTCTTGCGGGCCAAGCACGAGGCCAAGACGAAG
CTCTACGACGACTGCCTCTACGTCATCTACGCCCTGCCCCTGCTCAACGGCACGGACGGCTACCGCGTCCGCGGG
CGGCCCATGCTCAAGACGCCGGGGACGGGCAAGACGATGCTTGACCTGGAGATTGAGCGGAGCGAACGGCGTGAC
CACCACGAGGGGTACTTTGAAGACGACGCCTACACGACGCCCGAGAGCTTCGAGGGGGCGGGCCGCGGGGTGGCG
TCCTTCGGCGACCCATCGCCCGACGACGAAACGCAGCGAGACAATGAGGACGGGATACCGTCCCAGATCAACCGG
CTGGCCCCCGACGCCAAGAACTTTGCCGAGATGTTCGTCTTCTCGTACGGCGTCGTCGTCTTCTGGAACTTTACG
GAGCACCAAGAAAAGGACATCTTGGCGGACCTCACGTTTGCGGATGCCGAGGACGGCATCAGCCTGCTGACCAGG
CCCTTTGAGCAGGACAACTTCGAGACGGAGGAGTTTCACTTCGAGTACAGCGCCGACGTCAAGCGGCCGCGCGTC
TTCAACGACATGATCACCCTGCTGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCATGCCATCGCGCAG
AGCACCAAGCTGTGCTTCTTCGAGGAGCGGATGAGCGAGACGATGCTGGACGCGCAGCACGTGCCCAAGACGCTG
GCGCTGACGGGCCAGCTCAACATGACGAGGACGGAGATTGTCAAGATCTTGGGCAGGCTGTTCAAGAGCCGCGTC
GACATCAACCTCTGTAAGGTCCCACCACCCCCGTTTCTCGGGCGTCTTGAACAGAGGTCTGCCGAGAGCCCAGGT
TGGTGGGGGGAGACGGACAAGACGGATGCTGACCAGTCCGGCCCAGCTTCCAACATGCTCGACGTGCCCAACTTC
TTCTGGGACTCGGAGCCGACACTGCACCCGCTGTACGTGGCGGTGCGCGAGTATCTGGAGATCGACCCGCGCATC
AAGGTGCTCAACGAGCGCTGCCGCGTGTTCCTCGACCTGGCCGAGATACTGTCGGACTCGGTCAATGACGCCAAG
ATGAGTGCCATAACATGGACCGTCATTGTCCTGATCCTCGTCAGCATCCTGGTCACCGTGACCGAGGTCGGGCTG
CGATTTGTCATGCTGAGCAAGAACTCGGGCAAGGCGCCGGGAGCGGCGTCGTCGGCGGTGAGGTGGGCCAGCCCG
GCGGCGGCGGCCCCCGAGGTGGTGCTGGTGCCGGCGCCGGACAAGCAGGTACCGCTCGGGCGACAGGCTTCGCCG
GGGGCCGGGGCCGGCGGGCTGGAGGAGCTCGCGGCGGCGCTCGGGCTGCGGGGCAACGCCAGCATGGAGGACATC
AGGCAAGGCATCCTGGATTTGAGACGAGACGGCTCGACTGGCCGTCCGGAGCGCGCCGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail