Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3441
Gene name
LocationContig_19:56868..58564
Strand-
Gene length (bp)1696
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 1.7E-114 34 439

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 16 478 0.0E+00
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 18 478 1.0E-151
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 22 464 9.0E-151
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 28 478 2.0E-126
sp|P40260|MEP1_YEAST Ammonium transporter MEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP1 PE=1 SV=1 28 459 7.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 16 478 0.0E+00
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 18 478 1.0E-151
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 22 464 9.0E-151
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 28 478 2.0E-126
sp|P40260|MEP1_YEAST Ammonium transporter MEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP1 PE=1 SV=1 28 459 7.0E-126
sp|Q9P7F3|AMT3_SCHPO Ammonium transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt3 PE=3 SV=1 28 436 4.0E-97
sp|Q07429|NRGA_BACSU Ammonium transporter NrgA OS=Bacillus subtilis (strain 168) GN=nrgA PE=2 SV=1 29 440 3.0E-73
sp|O26759|Y663_METTH Putative ammonium transporter MTH_663 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_663 PE=3 SV=1 20 439 9.0E-69
sp|O66515|AMT_AQUAE Ammonia channel OS=Aquifex aeolicus (strain VF5) GN=amt PE=1 SV=1 29 418 3.0E-68
sp|P69681|AMTB_ECOLI Ammonia channel OS=Escherichia coli (strain K12) GN=amtB PE=1 SV=1 29 440 8.0E-65
sp|P69680|AMTB_ECO57 Ammonia channel OS=Escherichia coli O157:H7 GN=amtB PE=1 SV=1 29 440 8.0E-65
sp|O26757|Y661_METTH Putative ammonium transporter MTH_661 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_661 PE=3 SV=1 29 359 2.0E-63
sp|P9WQ65|AMT_MYCTU Probable ammonia channel OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amt PE=3 SV=1 29 459 3.0E-62
sp|P9WQ64|AMT_MYCTO Probable ammonia channel OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amt PE=3 SV=1 29 459 3.0E-62
sp|P63520|AMT_MYCBO Probable ammonia channel OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amt PE=3 SV=1 29 459 3.0E-62
sp|Q9BLG4|AMT1_DICDI Ammonium transporter 1 OS=Dictyostelium discoideum GN=amtA PE=1 SV=1 1 459 1.0E-56
sp|P54146|AMT_CORGL Ammonia channel OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=amt PE=2 SV=1 29 440 2.0E-49
sp|P54147|Y108_SYNY3 Putative ammonium transporter sll0108 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0108 PE=3 SV=1 10 439 2.0E-44
sp|Q69T29|AMT33_ORYSJ Ammonium transporter 3 member 3 OS=Oryza sativa subsp. japonica GN=AMT3-3 PE=2 SV=1 29 456 4.0E-42
sp|P54144|AMT11_ARATH Ammonium transporter 1 member 1 OS=Arabidopsis thaliana GN=AMT1-1 PE=1 SV=1 25 466 1.0E-41
sp|Q9ZPJ8|AMT12_ARATH Ammonium transporter 1 member 2 OS=Arabidopsis thaliana GN=AMT1-2 PE=1 SV=1 19 441 2.0E-40
sp|Q84KJ6|AMT31_ORYSJ Ammonium transporter 3 member 1 OS=Oryza sativa subsp. japonica GN=AMT3-1 PE=2 SV=1 29 439 4.0E-40
sp|O04161|AMT12_SOLLC Ammonium transporter 1 member 2 OS=Solanum lycopersicum GN=AMT1-2 PE=2 SV=1 18 462 8.0E-40
sp|Q9SVT8|AMT14_ARATH Ammonium transporter 1 member 4 OS=Arabidopsis thaliana GN=AMT1-4 PE=1 SV=1 35 443 4.0E-39
sp|Q6K9G1|AMT12_ORYSJ Ammonium transporter 1 member 2 OS=Oryza sativa subsp. japonica GN=AMT1-2 PE=2 SV=1 25 459 9.0E-39
sp|Q9LK16|AMT15_ARATH Putative ammonium transporter 1 member 5 OS=Arabidopsis thaliana GN=AMT1-5 PE=3 SV=1 25 443 2.0E-38
sp|Q7XQ12|AMT11_ORYSJ Ammonium transporter 1 member 1 OS=Oryza sativa subsp. japonica GN=AMT1-1 PE=2 SV=1 25 447 2.0E-37
sp|Q9SQH9|AMT13_ARATH Ammonium transporter 1 member 3 OS=Arabidopsis thaliana GN=AMT1-3 PE=2 SV=2 18 443 3.0E-37
sp|Q8S230|AMT22_ORYSJ Ammonium transporter 2 member 2 OS=Oryza sativa subsp. japonica GN=AMT2-2 PE=2 SV=2 17 439 7.0E-37
sp|Q9M6N7|AMT2_ARATH Ammonium transporter 2 OS=Arabidopsis thaliana GN=AMT2 PE=1 SV=2 17 450 3.0E-36
sp|Q851M9|AMT32_ORYSJ Ammonium transporter 3 member 2 OS=Oryza sativa subsp. japonica GN=AMT3-2 PE=2 SV=1 36 454 1.0E-35
sp|Q9FVN0|AMT13_SOLLC Ammonium transporter 1 member 3 OS=Solanum lycopersicum GN=AMT1-3 PE=2 SV=1 29 440 6.0E-35
sp|Q6K9G3|AMT13_ORYSJ Ammonium transporter 1 member 3 OS=Oryza sativa subsp. japonica GN=AMT1-3 PE=2 SV=1 25 458 4.0E-34
sp|Q84KJ7|AMT21_ORYSJ Ammonium transporter 2 member 1 OS=Oryza sativa subsp. japonica GN=AMT2-1 PE=2 SV=1 13 447 4.0E-34
sp|P58905|AMT11_SOLLC Ammonium transporter 1 member 1 OS=Solanum lycopersicum GN=AMT1-1 PE=2 SV=1 7 443 2.0E-33
sp|Q8S233|AMT23_ORYSJ Ammonium transporter 2 member 3 OS=Oryza sativa subsp. japonica GN=AMT2-3 PE=2 SV=1 17 447 6.0E-32
sp|P72935|Y1017_SYNY3 Putative ammonium transporter sll1017 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1017 PE=3 SV=1 2 436 2.0E-31
sp|Q9BLG3|AMT2_DICDI Ammonium transporter 2 OS=Dictyostelium discoideum GN=amtB PE=1 SV=1 42 441 3.0E-29
sp|P54148|Y537_SYNY3 Putative ammonium transporter sll0537 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0537 PE=3 SV=1 34 451 7.0E-29
sp|P54145|AMT1_CAEEL Putative ammonium transporter 1 OS=Caenorhabditis elegans GN=amt-1 PE=3 SV=1 7 439 2.0E-27
sp|Q8MXY0|AMT3_DICDI Ammonium transporter 3 OS=Dictyostelium discoideum GN=amtC PE=2 SV=1 39 439 8.0E-27
sp|Q21565|AMT3_CAEEL Putative ammonium transporter 3 OS=Caenorhabditis elegans GN=amt-3 PE=3 SV=2 34 435 4.0E-22
sp|Q58739|Y1343_METJA Putative ammonium transporter MJ1343 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1343 PE=1 SV=1 3 439 9.0E-22
sp|Q20605|AMT2_CAEEL Putative ammonium transporter 2 OS=Caenorhabditis elegans GN=amt-2 PE=3 SV=3 34 359 3.0E-18
sp|Q60366|Y058_METJA Putative ammonium transporter MJ0058 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0058 PE=3 SV=1 28 440 1.0E-17
sp|Q10CV4|AMT41_ORYSJ Putative ammonium transporter 4 member 1 OS=Oryza sativa subsp. japonica GN=AMT4-1 PE=3 SV=1 237 417 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0015696 ammonium transport Yes
GO:0016020 membrane Yes
GO:0008324 cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 62 84 22
3 122 144 22
4 149 171 22
5 186 208 22
6 221 243 22
7 253 275 22
8 287 309 22
9 313 335 22
10 342 364 22
11 391 413 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3441
MVAEMYNGTTDVADAGYSSKVSNLNIFYDTGHMVFITVSAVLVLLMIPGVGLFYSGLARRKSALQLVLLSMLSVA
VIGFQWFFWGYSLTFSRTGNAFLGDLSQFGLMKTIGRPNGSNLLPDILFCLYQGMFASITPALAIGAVADRGRML
PALVFMFIWSTVVYDPIAYWTWNTKGWLFNLPSYDFAGGGPVHIASGSCALAYSVMLGKRNGYSSIGGLPYRPHS
VTNVVLGTVFLWVGWFGFNGGSALGMNIRAVMSCYVTNLAASCAGITWVLLDYRLERKWSTIGFCSGAISGLVAI
TPAAGFVTPWAAVIIGVLGALCCNFATKLKFLIGVDDALDIFAVHGIGGMVGNLLTGIFGASYMAGLDGTAYPPI
GWIERNWVQLGKQLAGICAAFSWSFVFTCLILFLMNLVPGLSLRVTADDEDVGIDDCQLGEFAYDYVELTRHVAD
TSASVSDRNTSSDGSTAHEKIAGADAQDL*
Coding >Hirsu2|3441
ATGGTGGCTGAAATGTACAATGGCACGACGGACGTGGCCGACGCCGGCTACTCGTCGAAAGTGTCGAATCTCAAC
ATCTTCTACGACACCGGCCACATGGTCTTCATCACCGTCTCCGCCGTCCTGGTGCTGCTCATGATTCCGGGCGTC
GGTCTGTTCTACAGCGGCCTCGCCCGCCGCAAGTCGGCGCTGCAGCTCGTTCTCCTCTCGATGCTCTCCGTGGCC
GTCATCGGCTTCCAGTGGTTCTTCTGGGGATACTCCCTCACCTTCTCGCGGACCGGCAACGCCTTCCTCGGGGAC
CTTTCCCAGTTCGGCCTCATGAAGACGATCGGTCGGCCGAACGGGTCCAACTTGTTGCCCGACATTCTCTTCTGT
CTGTATCAGGGCATGTTTGCCTCGATTACTCCGGCCCTGGCCATTGGCGCGGTGGCTGATCGCGGCCGCATGCTC
CCGGCCCTCGTCTTCATGTTCATCTGGTCGACGGTCGTCTACGACCCGATCGCGTACTGGACGTGGAACACCAAG
GGCTGGCTCTTCAACCTGCCCAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCGCGTCGGGCAGCTGCGCG
CTCGCGTACAGCGTCATGCTCGGAAAGCGCAACGGCTACTCGAGCATCGGCGGCCTGCCGTACCGGCCGCACAGC
GTCACCAACGTCGTCCTCGGCACTGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGCTCGGCGCTGGGC
ATGAACATCCGGGCCGTCATGTCCTGCTACGTCACCAACCTGGCGGCCTCGTGCGCCGGCATCACCTGGGTCCTG
CTCGACTACCGGCTCGAGAGGAAGTGGAGCACCATCGGCTTCTGCTCCGGCGCCATCTCCGGCCTCGTCGCCATC
ACGCCGGCCGCCGGCTTCGTCACGCCCTGGGCGGCCGTCATCATCGGCGTCCTCGGCGCCCTGTGCTGCAACTTC
GCCACCAAGCTCAAGTTCCTCATCGGCGTCGACGACGCCCTCGACATCTTCGCCGTCCACGGCATCGGCGGCATG
GTGGGCAACCTCCTGACGGGCATCTTCGGCGCCTCCTACATGGCCGGCCTCGACGGCACCGCCTACCCGCCCATC
GGCTGGATCGAGCGCAACTGGGTGCAGCTCGGCAAGCAGCTGGCCGGCATCTGCGCCGCCTTCAGCTGGTCCTTC
GTCTTCACCTGCCTGATTCTCTTCCTCATGAACCTGGTCCCGGGCCTGTCGCTGCGCGTGACGGCCGACGACGAG
GACGTCGGCATCGACGACTGCCAGCTCGGCGAGTTCGCCTACGACTACGTCGAGCTGACGCGCCACGTCGCCGAC
ACCAGCGCCAGCGTCTCGGACCGCAACACGTCGTCGGACGGCTCGACCGCGCACGAGAAGATCGCGGGCGCCGAC
GCCCAGGACCTATGA
Transcript >Hirsu2|3441
ATGGTGGCTGAAATGTACAATGGCACGACGGACGTGGCCGACGCCGGCTACTCGTCGAAAGTGTCGAATCTCAAC
ATCTTCTACGACACCGGCCACATGGTCTTCATCACCGTCTCCGCCGTCCTGGTGCTGCTCATGATTCCGGGCGTC
GGTCTGTTCTACAGCGGCCTCGCCCGCCGCAAGTCGGCGCTGCAGCTCGTTCTCCTCTCGATGCTCTCCGTGGCC
GTCATCGGCTTCCAGTGGTTCTTCTGGGGATACTCCCTCACCTTCTCGCGGACCGGCAACGCCTTCCTCGGGGAC
CTTTCCCAGTTCGGCCTCATGAAGACGATCGGTCGGCCGAACGGGTCCAACTTGTTGCCCGACATTCTCTTCTGT
CTGTATCAGGGCATGTTTGCCTCGATTACTCCGGCCCTGGCCATTGGCGCGGTGGCTGATCGCGGCCGCATGCTC
CCGGCCCTCGTCTTCATGTTCATCTGGTCGACGGTCGTCTACGACCCGATCGCGTACTGGACGTGGAACACCAAG
GGCTGGCTCTTCAACCTGCCCAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCGCGTCGGGCAGCTGCGCG
CTCGCGTACAGCGTCATGCTCGGAAAGCGCAACGGCTACTCGAGCATCGGCGGCCTGCCGTACCGGCCGCACAGC
GTCACCAACGTCGTCCTCGGCACTGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGCTCGGCGCTGGGC
ATGAACATCCGGGCCGTCATGTCCTGCTACGTCACCAACCTGGCGGCCTCGTGCGCCGGCATCACCTGGGTCCTG
CTCGACTACCGGCTCGAGAGGAAGTGGAGCACCATCGGCTTCTGCTCCGGCGCCATCTCCGGCCTCGTCGCCATC
ACGCCGGCCGCCGGCTTCGTCACGCCCTGGGCGGCCGTCATCATCGGCGTCCTCGGCGCCCTGTGCTGCAACTTC
GCCACCAAGCTCAAGTTCCTCATCGGCGTCGACGACGCCCTCGACATCTTCGCCGTCCACGGCATCGGCGGCATG
GTGGGCAACCTCCTGACGGGCATCTTCGGCGCCTCCTACATGGCCGGCCTCGACGGCACCGCCTACCCGCCCATC
GGCTGGATCGAGCGCAACTGGGTGCAGCTCGGCAAGCAGCTGGCCGGCATCTGCGCCGCCTTCAGCTGGTCCTTC
GTCTTCACCTGCCTGATTCTCTTCCTCATGAACCTGGTCCCGGGCCTGTCGCTGCGCGTGACGGCCGACGACGAG
GACGTCGGCATCGACGACTGCCAGCTCGGCGAGTTCGCCTACGACTACGTCGAGCTGACGCGCCACGTCGCCGAC
ACCAGCGCCAGCGTCTCGGACCGCAACACGTCGTCGGACGGCTCGACCGCGCACGAGAAGATCGCGGGCGCCGAC
GCCCAGGACCTATGA
Gene >Hirsu2|3441
ATGGTGGCTGAAATGTACAATGGCACGACGGACGTGGCCGACGCCGGCTACTCGTCGAAAGTGTCGAATCTCAAC
ATCTTCTACGACGTATGTGCGCTTCTTTCTCTTGCACGCCGTGATGCGATCCCGGCCGCGGCCAAGCTGATCTGA
TGGGGTCGCCTCTCGCCTCCAGACCGGCCACATGGTCTTCATCACCGTCTCCGCCGTCCTGGTGCTGCTCATGAT
TCCGGGCGTCGGTCTGTTCTACAGCGGCCTCGCCCGCCGCAAGTCGGCGCTGCAGCTCGTTCTCCTCTCGATGCT
CTCCGTGGCCGTCATCGGCTTCCAGTGGTTCTTCTGGGGATACTCCCTCACCTTCTCGCGGACCGGCAACGCCTT
CCTCGGGGACCTTTCCCAGTTCGGCCTCATGAAGACGATCGGTCGGCCGAACGGGTCCAACTTGTTGCCCGACAT
TCTCTTCTGTCTGTATCAGGGCATGTTTGCCTCGATTACGTGCGTGGCCACGTCGATTTTTCTCTTCTCCCGCGT
CTCCTCCCGTTCTTCTGGCGTTACGTCTGGTTCAGATAGACTGACAGGCCCGAGATGTGCAGTCCGGCCCTGGCC
ATTGGCGCGGTGGCTGATCGCGGCCGCATGCTCCCGGCCCTCGTCTTCATGTTCATCTGGTCGACGGTCGTCTAC
GACCCGATCGCGTACTGGACGTGGAACACCAAGGGCTGGCTCTTCAACCTGCCCAGCTACGACTTCGCCGGCGGC
GGCCCCGTCCACATCGCGTCGGGCAGCTGCGCGCTCGCGTACAGCGTCATGCTCGGAAAGCGCAACGGCTACTCG
AGCATCGGCGGCCTGCCGTACCGGCCGCACAGCGTCACCAACGTCGTCCTCGGCACTGTCTTCCTCTGGGTCGGC
TGGTTCGGCTTCAACGGCGGCTCGGCGCTGGGCATGAACATCCGGGCCGTCATGTCCTGCTACGTCACCAACCTG
GCGGCCTCGTGCGCCGGCATCACCTGGGTCCTGCTCGACTACCGGCTCGAGAGGAAGTGGAGCACCATCGGCTTC
TGCTCCGGCGCCATCTCCGGCCTCGTCGCCATCACGCCGGCCGCCGGCTTCGTCACGCCCTGGGCGGCCGTCATC
ATCGGCGTCCTCGGCGCCCTGTGCTGCAACTTCGCCACCAAGCTCAAGTTCCTCATCGGCGTCGACGACGCCCTC
GACATCTTCGCCGTCCACGGCATCGGCGGCATGGTGGGCAACCTCCTGACGGGCATCTTCGGCGCGTGAGTTCTT
CTCTCCTACTTATTCCTGTCCTGGCCTCCCTCCTCTCCCGGTCTGACACCCGTCCTCGTTCAGCTCCTACATGGC
CGGCCTCGACGGCACCGCCTACCCGCCCATCGGCTGGATCGAGCGCAACTGGGTGCAGCTCGGCAAGCAGCTGGC
CGGCATCTGCGCCGCCTTCAGCTGGTCCTTCGTCTTCACCTGCCTGATTCTCTTCCTCATGAACCTGGTCCCGGG
CCTGTCGCTGCGCGTGACGGCCGACGACGAGGACGTCGGCATCGACGACTGCCAGCTCGGCGAGTTCGCCTACGA
CTACGTCGAGCTGACGCGCCACGTCGCCGACACCAGCGCCAGCGTCTCGGACCGCAACACGTCGTCGGACGGCTC
GACCGCGCACGAGAAGATCGCGGGCGCCGACGCCCAGGACCTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail