Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3438
Gene name
LocationContig_19:46693..47911
Strand-
Gene length (bp)1218
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16035 Chalcone_2 Chalcone isomerase like 1.0E-74 185 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BN19|AIM18_DEBHA Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM18 PE=3 SV=1 183 390 8.0E-29
sp|C5DRI2|AIM18_ZYGRC Altered inheritance of mitochondria protein 18, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM18 PE=3 SV=1 185 390 3.0E-25
sp|Q6CWH8|AIM18_KLULA Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM18 PE=3 SV=1 185 390 5.0E-25
sp|C5DFS5|AIM18_LACTC Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM18 PE=3 SV=1 190 393 2.0E-23
sp|B5VKC6|AIM18_YEAS6 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM18 PE=3 SV=1 186 393 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BN19|AIM18_DEBHA Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM18 PE=3 SV=1 183 390 8.0E-29
sp|C5DRI2|AIM18_ZYGRC Altered inheritance of mitochondria protein 18, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM18 PE=3 SV=1 185 390 3.0E-25
sp|Q6CWH8|AIM18_KLULA Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM18 PE=3 SV=1 185 390 5.0E-25
sp|C5DFS5|AIM18_LACTC Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM18 PE=3 SV=1 190 393 2.0E-23
sp|B5VKC6|AIM18_YEAS6 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM18 PE=3 SV=1 186 393 5.0E-20
sp|A6ZTA4|AIM18_YEAS7 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM18 PE=3 SV=1 186 393 6.0E-20
sp|A7TPW4|AIM18_VANPO Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM18 PE=3 SV=1 170 393 7.0E-20
sp|P38884|AIM18_YEAST Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM18 PE=1 SV=1 186 393 7.0E-20
sp|C8Z9Z8|AIM18_YEAS8 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM18 PE=3 SV=1 186 393 7.0E-20
sp|B3LSV8|AIM18_YEAS1 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM18 PE=3 SV=1 186 393 7.0E-20
sp|C7GRM0|AIM18_YEAS2 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM18 PE=3 SV=1 186 393 8.0E-20
sp|Q75DU9|AIM18_ASHGO Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM18 PE=3 SV=1 185 393 3.0E-19
sp|Q10102|YAQ1_SCHPO Uncharacterized protein C18G6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18G6.01c PE=4 SV=1 185 385 1.0E-16
sp|Q6FW60|AIM18_CANGA Altered inheritance of mitochondria protein 18, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AIM18 PE=3 SV=1 185 393 5.0E-11
sp|C7GRM1|AIM46_YEAS2 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM46 PE=3 SV=1 183 392 8.0E-10
sp|P38885|AIM46_YEAST Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM46 PE=1 SV=1 185 392 4.0E-09
sp|C8Z9Z9|AIM46_YEAS8 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM46 PE=3 SV=1 185 392 4.0E-09
sp|A6ZTA5|AIM46_YEAS7 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM46 PE=3 SV=1 185 392 4.0E-09
sp|B5VKC8|AIM46_YEAS6 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM46 PE=3 SV=1 185 392 4.0E-09
sp|B3LSV9|AIM46_YEAS1 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM46 PE=3 SV=1 185 392 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016872 intramolecular lyase activity Yes
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 62 81 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3438
MSTIRPAAAYARPVLGPSSRTLAARAAARRTLFSPRRPERATQDWDLNKLNAQRRDYEQHRTAFLAAGAVAGVIS
FIYTAWKLKQALAHERDKDQQAKEAKARARLAVKCDASIPTETFKTEAGEKRKVVVHDDEGREVVPTGNDVVPAF
PRLLTVDLPASQSAGGGGGSSSPIAASVSDEEGVEFTLVGLGMRSVTFIGFHVYLVGFYVATQDIARLQQYLVRK
INPVATTLIPAEKEALRTALLDATEGEQTWDALLREAGCRSAFRIMPVRDTDFHHLRDGFVRAIQARSQRDKACA
DEAFGAAMKDFKGLFNRGSVPKRKELLLCRNGDGSLAVLYGDGHPAKDARRAVVGVVHEERLSRLLWLNYLAGNK
VASEAARQNIIEGVMEFVQRPVGTVAAQVL*
Coding >Hirsu2|3438
ATGTCGACGATTCGACCGGCGGCGGCCTACGCCCGCCCCGTCCTTGGACCCTCGAGCCGAACGCTGGCAGCGCGG
GCGGCCGCACGCCGCACCCTCTTCTCGCCGAGACGGCCGGAGCGGGCGACGCAGGACTGGGACCTCAATAAGCTC
AATGCCCAGCGCCGTGACTACGAGCAGCACCGCACGGCCTTCCTCGCGGCCGGCGCCGTCGCCGGCGTCATCTCC
TTCATCTACACGGCCTGGAAGCTGAAACAGGCCCTCGCGCACGAGCGGGACAAAGACCAGCAGGCCAAGGAGGCG
AAGGCAAGGGCGAGGCTGGCCGTCAAGTGCGACGCGTCCATCCCGACCGAGACGTTCAAGACGGAGGCGGGTGAG
AAGCGCAAGGTCGTCGTGCACGACGACGAGGGCCGCGAGGTGGTGCCGACCGGCAACGACGTCGTGCCCGCCTTT
CCGCGCCTCTTGACGGTGGACCTGCCGGCCTCGCAGTCGGCGGGCGGCGGCGGCGGCAGTAGCAGCCCCATAGCC
GCTTCCGTCTCGGACGAGGAGGGCGTCGAGTTCACCCTCGTCGGGCTGGGCATGCGCAGCGTCACCTTCATCGGT
TTCCACGTCTACCTGGTCGGCTTCTACGTCGCGACGCAGGACATCGCGCGGCTGCAGCAGTACCTGGTCCGCAAG
ATCAACCCGGTGGCGACGACGCTGATACCGGCCGAGAAGGAGGCTCTGCGCACGGCACTGCTGGACGCCACCGAG
GGCGAGCAGACGTGGGACGCGCTGCTTCGGGAGGCCGGCTGCCGCAGCGCCTTCCGCATCATGCCCGTCCGCGAC
ACCGACTTCCACCACCTGCGCGACGGCTTCGTCCGCGCCATCCAGGCGCGGTCGCAGCGCGACAAGGCCTGCGCC
GATGAGGCCTTCGGCGCCGCCATGAAGGACTTCAAGGGCCTGTTCAACCGCGGCTCGGTGCCCAAGAGGAAGGAG
CTGCTTCTATGCCGCAACGGCGACGGCAGCCTGGCCGTACTGTACGGCGACGGCCATCCCGCCAAGGACGCCAGG
AGGGCCGTCGTCGGCGTCGTCCACGAAGAGCGGCTTTCCCGCCTGCTGTGGCTGAACTACCTGGCCGGGAACAAG
GTGGCGTCCGAGGCGGCGAGGCAAAACATCATCGAAGGTGTCATGGAGTTTGTGCAGCGGCCCGTCGGCACTGTA
GCGGCGCAGGTGCTGTAG
Transcript >Hirsu2|3438
ATGTCGACGATTCGACCGGCGGCGGCCTACGCCCGCCCCGTCCTTGGACCCTCGAGCCGAACGCTGGCAGCGCGG
GCGGCCGCACGCCGCACCCTCTTCTCGCCGAGACGGCCGGAGCGGGCGACGCAGGACTGGGACCTCAATAAGCTC
AATGCCCAGCGCCGTGACTACGAGCAGCACCGCACGGCCTTCCTCGCGGCCGGCGCCGTCGCCGGCGTCATCTCC
TTCATCTACACGGCCTGGAAGCTGAAACAGGCCCTCGCGCACGAGCGGGACAAAGACCAGCAGGCCAAGGAGGCG
AAGGCAAGGGCGAGGCTGGCCGTCAAGTGCGACGCGTCCATCCCGACCGAGACGTTCAAGACGGAGGCGGGTGAG
AAGCGCAAGGTCGTCGTGCACGACGACGAGGGCCGCGAGGTGGTGCCGACCGGCAACGACGTCGTGCCCGCCTTT
CCGCGCCTCTTGACGGTGGACCTGCCGGCCTCGCAGTCGGCGGGCGGCGGCGGCGGCAGTAGCAGCCCCATAGCC
GCTTCCGTCTCGGACGAGGAGGGCGTCGAGTTCACCCTCGTCGGGCTGGGCATGCGCAGCGTCACCTTCATCGGT
TTCCACGTCTACCTGGTCGGCTTCTACGTCGCGACGCAGGACATCGCGCGGCTGCAGCAGTACCTGGTCCGCAAG
ATCAACCCGGTGGCGACGACGCTGATACCGGCCGAGAAGGAGGCTCTGCGCACGGCACTGCTGGACGCCACCGAG
GGCGAGCAGACGTGGGACGCGCTGCTTCGGGAGGCCGGCTGCCGCAGCGCCTTCCGCATCATGCCCGTCCGCGAC
ACCGACTTCCACCACCTGCGCGACGGCTTCGTCCGCGCCATCCAGGCGCGGTCGCAGCGCGACAAGGCCTGCGCC
GATGAGGCCTTCGGCGCCGCCATGAAGGACTTCAAGGGCCTGTTCAACCGCGGCTCGGTGCCCAAGAGGAAGGAG
CTGCTTCTATGCCGCAACGGCGACGGCAGCCTGGCCGTACTGTACGGCGACGGCCATCCCGCCAAGGACGCCAGG
AGGGCCGTCGTCGGCGTCGTCCACGAAGAGCGGCTTTCCCGCCTGCTGTGGCTGAACTACCTGGCCGGGAACAAG
GTGGCGTCCGAGGCGGCGAGGCAAAACATCATCGAAGGTGTCATGGAGTTTGTGCAGCGGCCCGTCGGCACTGTA
GCGGCGCAGGTGCTGTAG
Gene >Hirsu2|3438
ATGTCGACGATTCGACCGGCGGCGGCCTACGCCCGCCCCGTCCTTGGACCCTCGAGCCGAACGCTGGCAGCGCGG
GCGGCCGCACGCCGCACCCTCTTCTCGCCGAGACGGCCGGAGCGGGCGACGCAGGACTGGGACCTCAATAAGCTC
AATGCCCAGCGCCGTGACTACGAGCAGCACCGCACGGCCTTCCTCGCGGCCGGCGCCGTCGCCGGCGTCATCTCC
TTCATCTACACGGCCTGGAAGCTGAAACAGGCCCTCGCGCACGAGCGGGACAAAGACCAGCAGGCCAAGGAGGCG
AAGGCAAGGGCGAGGCTGGCCGTCAAGTGCGACGCGTCCATCCCGACCGAGACGTTCAAGACGGAGGCGGGTGAG
AAGCGCAAGGTCGTCGTGCACGACGACGAGGGCCGCGAGGTGGTGCCGACCGGCAACGACGTCGTGCCCGCCTTT
CCGCGCCTCTTGACGGTGGACCTGCCGGCCTCGCAGTCGGCGGGCGGCGGCGGCGGCAGTAGCAGCCCCATAGCC
GCTTCCGTCTCGGACGAGGAGGGCGTCGAGTTCACCCTCGTCGGGCTGGGCATGCGCAGCGTCACCTTCATCGGT
TTCCACGTCTACCTGGTCGGCTTCTACGTCGCGACGCAGGACATCGCGCGGCTGCAGCAGTACCTGGTCCGCAAG
ATCAACCCGGTGGCGACGACGCTGATACCGGCCGAGAAGGAGGCTCTGCGCACGGCACTGCTGGACGCCACCGAG
GGCGAGCAGACGTGGGACGCGCTGCTTCGGGAGGCCGGCTGCCGCAGCGCCTTCCGCATCATGCCCGTCCGCGAC
ACCGACTTCCACCACCTGCGCGACGGCTTCGTCCGCGCCATCCAGGCGCGGTCGCAGCGCGACAAGGCCTGCGCC
GATGAGGCCTTCGGCGCCGCCATGAAGGACTTCAAGGGCCTGTTCAACCGCGGCTCGGTGCCCAAGAGGAAGGAG
CTGCTTCTATGCCGCAACGGCGACGGCAGCCTGGCCGTACTGTACGGCGACGGCCATCCCGCCAAGGACGCCAGG
AGGGCCGTCGTCGGCGTCGTCCACGAAGAGCGGCTTTCCCGCCTGCTGTGGCTGAACTACCTGGCCGGGAACAAG
GTGGCGTCCGAGGCGGCGAGGCAAAACATCATCGAAGGTGTCATGGAGTTTGTGCAGCGGCCCGTCGGCACTGTA
GCGGCGCAGGTGCTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail