Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3433
Gene name
LocationContig_19:37110..37958
Strand+
Gene length (bp)848
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7522 0.2773 0.1017 0.3147 0.2453 0.0129 0.1053 0.1061 0.1478 0.1494

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2418
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1566
Ophiocordyceps australis map64 (Brazil) OphauB2|4788
Ophiocordyceps camponoti-floridani Ophcf2|03410
Ophiocordyceps camponoti-rufipedis Ophun1|1275
Ophiocordyceps kimflemingae Ophio5|3881
Ophiocordyceps subramaniannii Hirsu2|3433 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3433
MPTSLESSRPIMAPSTRTSVRFSTYSMAAPSLSPTVQTSDSAQAEIRDIAQGLDRMENKALTSQRVALTDEKTDK
LGKLALGAKLERALDRRMSSQDAVMRPRPKSVAIGLSLNEKKQLSEKAS*
Coding >Hirsu2|3433
ATGCCCACCTCGCTGGAGTCGTCTCGCCCCATCATGGCTCCGTCGACCCGTACTTCGGTTCGCTTCAGCACCTAC
AGCATGGCGGCCCCGTCCCTGTCGCCGACGGTGCAGACCTCGGACTCGGCCCAGGCGGAGATTCGCGACATCGCC
CAGGGCCTCGACCGCATGGAGAACAAGGCCCTGACCTCCCAGCGAGTCGCCCTCACCGACGAGAAGACGGACAAG
CTGGGCAAGCTCGCCCTCGGCGCCAAGCTGGAACGCGCCCTCGACCGCCGCATGAGCAGCCAGGACGCCGTCATG
CGCCCGCGCCCCAAAAGCGTCGCCATCGGCCTCTCCCTCAACGAAAAGAAGCAGCTCTCGGAAAAGGCTTCCTAG
Transcript >Hirsu2|3433
ATGCCCACCTCGCTGGAGTCGTCTCGCCCCATCATGGCTCCGTCGACCCGTACTTCGGTTCGCTTCAGCACCTAC
AGCATGGCGGCCCCGTCCCTGTCGCCGACGGTGCAGACCTCGGACTCGGCCCAGGCGGAGATTCGCGACATCGCC
CAGGGCCTCGACCGCATGGAGAACAAGGCCCTGACCTCCCAGCGAGTCGCCCTCACCGACGAGAAGACGGACAAG
CTGGGCAAGCTCGCCCTCGGCGCCAAGCTGGAACGCGCCCTCGACCGCCGCATGAGCAGCCAGGACGCCGTCATG
CGCCCGCGCCCCAAAAGCGTCGCCATCGGCCTCTCCCTCAACGAAAAGAAGCAGCTCTCGGAAAAGGCTTCCTAG
Gene >Hirsu2|3433
ATGCCCACCTCGCTGGAGTCGTCTCGCCCCATCATGGCTCCGTCGGTACGTAGGCCGTTTTGCTTTTCCTCCGTT
TTACCTCTTGTCTGGTCTCTGCTGCTAGCCACTTGCTGTCTTTCCTCCTCCTCCTCGCTCTGTTTCAATCTCACC
TCGACTTCTGCCCTCCACCACCCATCTGTGTGTCTCATTCTCCCTTGGACCTCACTGCCTCACTCACACACGCAC
ACACACACACACACACACCCATCTCTTCGAAAAAGAAAAAAAACAAACACGGCCGTGGCCGGGTATCCAACAGGT
GAAATTACCTCGAGACGCGCCCTGCCGGCGTCGTCGAACGTCCTCTGGCACATCCCTACCCTCTTCACCTCTGCT
CCTCCAATGTCCCATCTCACCACCGTCCCCGCCCGCCCGCTTCTTTCAGCCCGGTGCCTTCGCTGCGTCCCCCCT
CTCGCCCTTTCGCGCCAATGCCGCTTCCGCTTCGTCTCCCTCCTAGGCTGACCATGCATCGCCGACAGACCCGTA
CTTCGGTTCGCTTCAGCACCTACAGCATGGCGGCCCCGTCCCTGTCGCCGACGGTGCAGACCTCGGACTCGGCCC
AGGCGGAGATTCGCGACATCGCCCAGGGCCTCGACCGCATGGAGAACAAGGCCCTGACCTCCCAGCGAGTCGCCC
TCACCGACGAGAAGACGGACAAGCTGGGCAAGCTCGCCCTCGGCGCCAAGCTGGAACGCGCCCTCGACCGCCGCA
TGAGCAGCCAGGACGCCGTCATGCGCCCGCGCCCCAAAAGCGTCGCCATCGGCCTCTCCCTCAACGAAAAGAAGC
AGCTCTCGGAAAAGGCTTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail