Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3423
Gene name
LocationContig_19:19111..20247
Strand+
Gene length (bp)1136
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 3.6E-46 31 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CD92|AQY1_YEASX Aquaporin-1 OS=Saccharomyces cerevisiae GN=AQY1 PE=2 SV=1 10 274 8.0E-51
sp|P0CD89|AQY2_YEASX Aquaporin-2 OS=Saccharomyces cerevisiae GN=AQY2 PE=2 SV=1 10 263 1.0E-50
sp|C8ZJM1|AQY1_YEAS8 Aquaporin-1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AQY1 PE=2 SV=1 10 274 4.0E-50
sp|P0CD91|AQY1_YEAST Aquaporin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQY1 PE=1 SV=1 10 261 2.0E-48
sp|A6ZX66|AQY1_YEAS7 Aquaporin-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AQY1 PE=2 SV=1 10 261 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CD92|AQY1_YEASX Aquaporin-1 OS=Saccharomyces cerevisiae GN=AQY1 PE=2 SV=1 10 274 8.0E-51
sp|P0CD89|AQY2_YEASX Aquaporin-2 OS=Saccharomyces cerevisiae GN=AQY2 PE=2 SV=1 10 263 1.0E-50
sp|C8ZJM1|AQY1_YEAS8 Aquaporin-1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AQY1 PE=2 SV=1 10 274 4.0E-50
sp|P0CD91|AQY1_YEAST Aquaporin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQY1 PE=1 SV=1 10 261 2.0E-48
sp|A6ZX66|AQY1_YEAS7 Aquaporin-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AQY1 PE=2 SV=1 10 261 2.0E-48
sp|O77750|AQP4_BOVIN Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3 32 315 1.0E-34
sp|Q7PWV1|AQP_ANOGA Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4 26 246 1.0E-34
sp|P55088|AQP4_MOUSE Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=1 SV=2 32 302 2.0E-34
sp|P47863|AQP4_RAT Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1 32 308 2.0E-34
sp|Q5I4F9|AQP4_NOTAL Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1 32 302 2.0E-34
sp|Q923J4|AQP4_DIPME Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1 32 315 3.0E-34
sp|P55087|AQP4_HUMAN Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2 32 302 8.0E-34
sp|Q6PQZ1|AQP1_PIG Aquaporin-1 OS=Sus scrofa GN=AQP1 PE=2 SV=3 32 265 6.0E-33
sp|Q5R819|AQP1_PONAB Aquaporin-1 OS=Pongo abelii GN=AQP1 PE=2 SV=3 32 265 2.0E-32
sp|P29972|AQP1_HUMAN Aquaporin-1 OS=Homo sapiens GN=AQP1 PE=1 SV=3 32 267 2.0E-32
sp|P47865|AQP1_BOVIN Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3 32 265 6.0E-32
sp|Q9N2J4|AQP1_CANLF Aquaporin-1 OS=Canis lupus familiaris GN=AQP1 PE=2 SV=3 32 267 1.0E-31
sp|Q9U8P7|AQPA_DICDI Aquaporin A OS=Dictyostelium discoideum GN=aqpA PE=2 SV=1 78 247 2.0E-31
sp|P29975|AQP1_RAT Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=1 SV=4 32 265 3.0E-31
sp|Q02013|AQP1_MOUSE Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3 32 265 8.0E-31
sp|Q9WTY0|AQP6_RAT Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1 64 254 4.0E-30
sp|Q9NHW7|AQP_AEDAE Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 PE=2 SV=2 23 246 4.0E-30
sp|P34080|AQP2_RAT Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1 32 269 7.0E-30
sp|P56402|AQP2_MOUSE Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=1 SV=2 32 269 9.0E-30
sp|Q9ATL5|TIP42_MAIZE Aquaporin TIP4-2 OS=Zea mays GN=TIP4-2 PE=2 SV=1 32 262 2.0E-29
sp|P56401|AQP1_SHEEP Aquaporin-1 OS=Ovis aries GN=AQP1 PE=1 SV=3 32 269 2.0E-29
sp|P50501|AQPA_PELES Aquaporin FA-CHIP OS=Pelophylax esculentus GN=AQPA PE=2 SV=1 32 267 3.0E-29
sp|O62735|AQP2_SHEEP Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1 32 269 6.0E-29
sp|Q6J8I9|MIP_SHEEP Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1 67 247 9.0E-29
sp|P79099|AQP2_BOVIN Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2 32 269 9.0E-29
sp|Q06019|MIP_LITPI Lens fiber major intrinsic protein OS=Lithobates pipiens PE=1 SV=1 67 247 1.0E-28
sp|Q75GA5|TIP41_ORYSJ Probable aquaporin TIP4-1 OS=Oryza sativa subsp. japonica GN=TIP4-1 PE=2 SV=1 32 260 1.0E-28
sp|P06624|MIP_BOVIN Lens fiber major intrinsic protein OS=Bos taurus GN=MIP PE=1 SV=1 67 247 2.0E-28
sp|P41181|AQP2_HUMAN Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1 32 269 2.0E-28
sp|A4L9J0|MIP_RABIT Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1 67 247 3.0E-28
sp|P0CD98|YLL53_YEAST Putative uncharacterized protein YLL053C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL053C PE=5 SV=1 138 263 4.0E-28
sp|C8ZCS2|YLL53_YEAS8 Putative uncharacterized protein EC1118_1L10_0100g OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1L10_0100g PE=5 SV=1 138 263 4.0E-28
sp|C7GNE2|YLL53_YEAS2 Putative uncharacterized protein C1Q_01798 OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_01798 PE=5 SV=1 138 263 4.0E-28
sp|B3LTC4|YLL53_YEAS1 Putative uncharacterized protein SCRG_04940 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_04940 PE=5 SV=1 138 263 4.0E-28
sp|Q9WTY4|AQP5_MOUSE Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=1 SV=1 69 244 6.0E-28
sp|A8W649|AQP5_PIG Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1 29 244 6.0E-28
sp|A7A0K7|YLL53_YEAS7 Putative uncharacterized protein SCY_3531 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_3531 PE=5 SV=1 137 263 8.0E-28
sp|A2IBY8|MIP_CANLF Lens fiber major intrinsic protein OS=Canis lupus familiaris GN=MIP PE=2 SV=1 67 247 1.0E-27
sp|P30301|MIP_HUMAN Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1 67 247 1.0E-27
sp|Q9V5Z7|AQP_DROME Aquaporin OS=Drosophila melanogaster GN=Drip PE=2 SV=2 32 247 1.0E-27
sp|P09011|MIP_RAT Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2 67 247 2.0E-27
sp|Q41951|TIP21_ARATH Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1 PE=1 SV=2 33 240 2.0E-27
sp|P51180|MIP_MOUSE Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2 67 247 3.0E-27
sp|Q9FGL2|TIP23_ARATH Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3 PE=1 SV=1 35 240 9.0E-27
sp|Q23808|AQP_CICVR Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1 35 265 1.0E-26
sp|Q9ATL6|TIP41_MAIZE Aquaporin TIP4-1 OS=Zea mays GN=TIP4-1 PE=2 SV=1 32 247 1.0E-26
sp|Q13520|AQP6_HUMAN Aquaporin-6 OS=Homo sapiens GN=AQP6 PE=2 SV=2 64 254 1.0E-26
sp|Q866S3|AQP5_SHEEP Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1 69 244 2.0E-26
sp|P21653|TIP1_TOBAC Probable aquaporin TIP-type RB7-5A OS=Nicotiana tabacum PE=2 SV=1 33 240 2.0E-26
sp|Q8C4A0|AQP6_MOUSE Aquaporin-6 OS=Mus musculus GN=Aqp6 PE=2 SV=1 64 254 2.0E-26
sp|P24422|TIP2_TOBAC Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2 33 240 5.0E-26
sp|Q9ATL4|TIP43_MAIZE Aquaporin TIP4-3 OS=Zea mays GN=TIP4-3 PE=2 SV=1 32 260 6.0E-26
sp|P33560|TIP_ANTMA Probable aquaporin TIP-type OS=Antirrhinum majus GN=DIP PE=2 SV=1 33 240 6.0E-26
sp|Q84RL6|TIP23_MAIZE Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2 33 253 9.0E-26
sp|P55064|AQP5_HUMAN Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1 69 244 1.0E-25
sp|P47864|AQP5_RAT Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1 69 244 1.0E-25
sp|O82316|TIP41_ARATH Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1 PE=2 SV=1 90 240 1.0E-25
sp|P26587|TIP31_ARATH Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1 PE=2 SV=1 22 247 2.0E-25
sp|Q41963|TIP12_ARATH Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2 27 247 2.0E-25
sp|O22588|TIP32_ARATH Probable aquaporin TIP3-2 OS=Arabidopsis thaliana GN=TIP3-2 PE=2 SV=1 89 247 3.0E-25
sp|Q25074|AQP_HAEIX Aquaporin OS=Haematobia irritans exigua PE=2 SV=1 35 247 5.0E-25
sp|Q9ATL3|TIP44_MAIZE Aquaporin TIP4-4 OS=Zea mays GN=TIP4-4 PE=2 SV=1 19 245 8.0E-25
sp|Q5Z6F0|TIP22_ORYSJ Probable aquaporin TIP2-2 OS=Oryza sativa subsp. japonica GN=TIP2-2 PE=2 SV=1 33 244 1.0E-24
sp|Q9LWR0|TIP42_ORYSJ Probable aquaporin TIP4-2 OS=Oryza sativa subsp. japonica GN=TIP4-2 PE=2 SV=2 27 256 1.0E-24
sp|Q54V53|AQPC_DICDI Aquaporin C OS=Dictyostelium discoideum GN=wacA PE=2 SV=1 32 240 2.0E-24
sp|Q9ATM0|TIP12_MAIZE Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1 90 247 3.0E-24
sp|Q41975|TIP22_ARATH Probable aquaporin TIP2-2 OS=Arabidopsis thaliana GN=TIP2-2 PE=1 SV=2 35 240 3.0E-24
sp|P42767|PIP1_ATRCA Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1 33 244 3.0E-24
sp|O82598|TIP13_ARATH Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1 36 247 6.0E-24
sp|Q9ATL8|TIP22_MAIZE Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1 33 244 7.0E-24
sp|Q7XA61|TIP21_ORYSJ Probable aquaporin TIP2-1 OS=Oryza sativa subsp. japonica GN=TIP2-1 PE=2 SV=1 33 262 2.0E-23
sp|P56404|AQP8_MOUSE Aquaporin-8 OS=Mus musculus GN=Aqp8 PE=2 SV=1 32 238 2.0E-23
sp|P56405|AQP8_RAT Aquaporin-8 OS=Rattus norvegicus GN=Aqp8 PE=2 SV=1 35 238 2.0E-23
sp|Q7XSQ9|PIP12_ORYSJ Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3 33 240 3.0E-23
sp|Q5I4F8|AQP8_NOTAL Aquaporin-8 OS=Notomys alexis GN=AQP8 PE=2 SV=1 35 238 3.0E-23
sp|P43286|PIP21_ARATH Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1 32 240 4.0E-23
sp|Q9XF59|PIP12_MAIZE Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1 33 240 4.0E-23
sp|Q9AQU5|PIP13_MAIZE Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1 33 240 4.0E-23
sp|Q9ZVX8|PIP28_ARATH Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1 32 244 4.0E-23
sp|Q6RZ07|MIP_CAVPO Lens fiber major intrinsic protein OS=Cavia porcellus GN=MIP PE=1 SV=1 90 247 6.0E-23
sp|Q94CS9|TIP12_ORYSJ Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1 90 247 1.0E-22
sp|Q7Y1E6|PIP28_ORYSJ Probable aquaporin PIP2-8 OS=Oryza sativa subsp. japonica GN=PIP2-8 PE=2 SV=1 3 241 1.0E-22
sp|Q9AR14|PIP15_MAIZE Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1 33 240 1.0E-22
sp|Q9FY14|TIP1_MEDTR Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1 33 247 2.0E-22
sp|Q9LWR2|TIP43_ORYSJ Probable aquaporin TIP4-3 OS=Oryza sativa subsp. japonica GN=TIP4-3 PE=2 SV=1 89 247 2.0E-22
sp|P30302|PIP23_ARATH Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1 32 240 2.0E-22
sp|P43287|PIP22_ARATH Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2 32 240 3.0E-22
sp|Q9SV31|PIP25_ARATH Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1 32 240 3.0E-22
sp|Q9ATM5|PIP26_MAIZE Aquaporin PIP2-6 OS=Zea mays GN=PIP2-6 PE=2 SV=1 32 240 3.0E-22
sp|Q7XLR1|PIP26_ORYSJ Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2 32 247 5.0E-22
sp|P25818|TIP11_ARATH Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1 27 247 6.0E-22
sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonica GN=PIP1-3 PE=2 SV=2 33 240 6.0E-22
sp|Q9XF58|PIP25_MAIZE Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1 32 244 7.0E-22
sp|Q41870|PIP11_MAIZE Aquaporin PIP1-1 OS=Zea mays GN=PIP1-1 PE=1 SV=1 33 240 8.0E-22
sp|Q6K215|PIP22_ORYSJ Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1 32 244 9.0E-22
sp|Q6EU94|PIP11_ORYSJ Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1 33 240 9.0E-22
sp|Q8GRT8|PIP24_ORYSJ Aquaporin PIP2-4 OS=Oryza sativa subsp. japonica GN=PIP2-4 PE=2 SV=1 32 240 1.0E-21
sp|Q9ATL9|TIP21_MAIZE Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1 33 244 1.0E-21
sp|Q9ATM4|PIP27_MAIZE Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1 33 240 4.0E-21
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 33 240 5.0E-21
sp|P93004|PIP27_ARATH Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2 32 244 6.0E-21
sp|Q8GRI8|PIP25_ORYSJ Aquaporin PIP2-5 OS=Oryza sativa subsp. japonica GN=PIP2-5 PE=2 SV=1 32 240 7.0E-21
sp|Q9AT75|TIP32_MAIZE Aquaporin TIP3-2 OS=Zea mays GN=TIP3-2 PE=2 SV=1 22 247 7.0E-21
sp|Q7XUA6|PIP23_ORYSJ Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1 32 244 7.0E-21
sp|Q9ATM6|PIP24_MAIZE Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1 32 244 9.0E-21
sp|P61838|PIP11_VICFA Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1 33 240 1.0E-20
sp|P61837|PIP11_ARATH Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1 PE=1 SV=1 33 240 1.0E-20
sp|O64964|TIP11_MAIZE Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1 27 247 1.0E-20
sp|Q9FF53|PIP24_ARATH Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1 32 240 1.0E-20
sp|Q9ATM7|PIP23_MAIZE Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1 32 244 1.0E-20
sp|Q06611|PIP12_ARATH Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2 PE=1 SV=1 33 240 1.0E-20
sp|Q9ATN0|PIP16_MAIZE Aquaporin PIP1-6 OS=Zea mays GN=PIP1-6 PE=2 SV=1 33 240 1.0E-20
sp|Q8LAA6|PIP15_ARATH Probable aquaporin PIP1-5 OS=Arabidopsis thaliana GN=PIP1-5 PE=2 SV=2 33 240 2.0E-20
sp|Q8H5N9|PIP21_ORYSJ Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1 32 240 2.0E-20
sp|Q84RL7|PIP21_MAIZE Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2 32 240 5.0E-20
sp|Q08733|PIP13_ARATH Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1 33 247 5.0E-20
sp|P42067|TIP1_MEDSA Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2 33 247 7.0E-20
sp|P50156|TIP11_ORYSJ Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1 27 247 8.0E-20
sp|P23645|BIB_DROME Neurogenic protein big brain OS=Drosophila melanogaster GN=bib PE=1 SV=2 32 247 1.0E-19
sp|Q9ATL7|TIP31_MAIZE Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1 91 247 1.0E-19
sp|Q651D5|PIP27_ORYSJ Probable aquaporin PIP2-7 OS=Oryza sativa subsp. japonica GN=PIP2-7 PE=2 SV=2 32 247 1.0E-19
sp|Q08451|PIP1_SOLLC Probable aquaporin PIP-type pTOM75 OS=Solanum lycopersicum PE=2 SV=1 33 240 1.0E-19
sp|Q39196|PIP14_ARATH Probable aquaporin PIP1-4 OS=Arabidopsis thaliana GN=PIP1.4 PE=1 SV=1 33 240 2.0E-19
sp|Q9ATM8|PIP22_MAIZE Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1 32 240 3.0E-19
sp|Q9FWV6|TIP31_ORYSJ Probable aquaporin TIP3-1 OS=Oryza sativa subsp. japonica GN=TIP3-1 PE=2 SV=1 91 247 5.0E-19
sp|O94778|AQP8_HUMAN Aquaporin-8 OS=Homo sapiens GN=AQP8 PE=2 SV=2 35 231 6.0E-19
sp|P28238|MIP_CHICK Lens fiber major intrinsic protein OS=Gallus gallus GN=MIP PE=1 SV=2 32 231 7.0E-19
sp|Q9ZV07|PIP26_ARATH Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1 32 240 3.0E-18
sp|Q7XKI5|TIP32_ORYSJ Probable aquaporin TIP3-2 OS=Oryza sativa subsp. japonica GN=TIP3-2 PE=2 SV=2 92 247 1.0E-17
sp|Q0DK16|NIP13_ORYSJ Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2 1 251 2.0E-17
sp|Q9STX9|TIP51_ARATH Probable aquaporin TIP5-1 OS=Arabidopsis thaliana GN=TIP5-1 PE=2 SV=1 27 244 2.0E-17
sp|P23958|TIPA_PHAVU Probable aquaporin TIP-type alpha OS=Phaseolus vulgaris PE=1 SV=1 90 233 4.0E-17
sp|Q9ATL2|TIP51_MAIZE Aquaporin TIP5-1 OS=Zea mays GN=TIP5-1 PE=2 SV=1 33 247 6.0E-17
sp|Q7EYH7|NIP32_ORYSJ Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1 35 248 6.0E-16
sp|Q92NM3|AQPZ1_RHIME Aquaporin Z 1 OS=Rhizobium meliloti (strain 1021) GN=aqpZ1 PE=3 SV=1 35 240 1.0E-15
sp|Q9SAI4|NIP61_ARATH Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1 PE=1 SV=1 35 255 8.0E-15
sp|Q9C6T0|NIP31_ARATH Aquaporin NIP3-1 OS=Arabidopsis thaliana GN=NIP3-1 PE=2 SV=2 32 248 9.0E-15
sp|Q7W917|AQPZ_BORPA Aquaporin Z OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aqpZ PE=3 SV=1 35 247 2.0E-14
sp|Q7WKG2|AQPZ_BORBR Aquaporin Z OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aqpZ PE=3 SV=1 35 247 2.0E-14
sp|Q84S07|NIP33_ORYSJ Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1 16 248 2.0E-14
sp|Q40746|NIP11_ORYSJ Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1 32 251 2.0E-14
sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2 73 265 3.0E-14
sp|Q8VZW1|NIP11_ARATH Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1 PE=1 SV=1 8 251 4.0E-14
sp|Q7XU31|TIP51_ORYSJ Probable aquaporin TIP5-1 OS=Oryza sativa subsp. japonica GN=TIP5;1 PE=2 SV=3 28 240 5.0E-14
sp|Q9FIZ9|NIP41_ARATH Putative aquaporin NIP4-1 OS=Arabidopsis thaliana GN=NIP4-1 PE=3 SV=1 73 251 5.0E-14
sp|Q89EG9|AQPZ_BRADU Aquaporin Z OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aqpZ PE=3 SV=1 64 253 1.0E-13
sp|Q9C4Z5|AQPM_METTM Aquaporin AqpM OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=aqpM PE=1 SV=4 33 248 2.0E-13
sp|Q8LFP7|NIP12_ARATH Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2 PE=2 SV=2 32 251 3.0E-13
sp|Q9HWZ3|AQPZ_PSEAE Aquaporin Z OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aqpZ PE=3 SV=1 35 247 4.0E-13
sp|Q8EHC1|AQPZ_SHEON Aquaporin Z OS=Shewanella oneidensis (strain MR-1) GN=aqpZ PE=3 SV=2 35 244 5.0E-13
sp|O26206|AQPM_METTH Aquaporin AqpM OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aqpM PE=3 SV=1 33 248 5.0E-13
sp|Q54WT8|AQPB_DICDI Aquaporin-B OS=Dictyostelium discoideum GN=aqpB PE=1 SV=1 32 240 8.0E-13
sp|Q0IWF3|NIP31_ORYSJ Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2 35 257 8.0E-13
sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica GN=NIP1-4 PE=2 SV=1 1 254 9.0E-13
sp|Q88F17|AQPZ_PSEPK Aquaporin Z OS=Pseudomonas putida (strain KT2440) GN=aqpZ PE=3 SV=1 35 244 9.0E-13
sp|Q0JPT5|NIP12_ORYSJ Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica GN=NIP1-2 PE=2 SV=2 27 251 9.0E-13
sp|Q8W036|NIP42_ARATH Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2 73 251 1.0E-12
sp|Q9ATN1|NIP31_MAIZE Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1 35 257 1.0E-12
sp|Q7NNP3|AQPZ_GLOVI Aquaporin Z OS=Gloeobacter violaceus (strain PCC 7421) GN=aqpZ PE=3 SV=1 33 262 2.0E-12
sp|Q9SV84|NIP51_ARATH Probable aquaporin NIP5-1 OS=Arabidopsis thaliana GN=NIP5-1 PE=2 SV=1 35 257 2.0E-12
sp|Q8FY85|AQPZ_BRUSU Aquaporin Z OS=Brucella suis biovar 1 (strain 1330) GN=aqpZ PE=3 SV=1 35 239 3.0E-12
sp|Q8DB17|AQPZ_VIBVU Aquaporin Z OS=Vibrio vulnificus (strain CMCP6) GN=aqpZ PE=3 SV=1 64 248 4.0E-12
sp|P49173|NIP1_NICAL Probable aquaporin NIP-type OS=Nicotiana alata PE=2 SV=1 73 265 4.0E-12
sp|Q7MIV9|AQPZ_VIBVY Aquaporin Z OS=Vibrio vulnificus (strain YJ016) GN=aqpZ PE=3 SV=1 64 248 2.0E-11
sp|Q9ATN4|NIP11_MAIZE Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1 9 251 2.0E-11
sp|P73809|AQPZ_SYNY3 Aquaporin Z OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aqpZ PE=3 SV=1 33 248 4.0E-11
sp|Q7NU39|AQPZ_CHRVO Aquaporin Z OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aqpZ PE=3 SV=1 73 247 7.0E-11
sp|Q92ZW9|AQPZ2_RHIME Aquaporin Z 2 OS=Rhizobium meliloti (strain 1021) GN=aqpZ2 PE=3 SV=1 64 240 2.0E-10
sp|P0C112|AQPZ_BRUAB Aquaporin Z OS=Brucella abortus biovar 1 (strain 9-941) GN=aqpZ PE=3 SV=1 35 239 2.0E-10
sp|Q2YR68|AQPZ_BRUA2 Aquaporin Z OS=Brucella abortus (strain 2308) GN=aqpZ PE=3 SV=1 35 239 2.0E-10
sp|Q8W037|NIP21_ARATH Aquaporin NIP2-1 OS=Arabidopsis thaliana GN=NIP2-1 PE=2 SV=2 5 257 3.0E-10
sp|Q8LAI1|NIP71_ARATH Probable aquaporin NIP7-1 OS=Arabidopsis thaliana GN=NIP7-1 PE=2 SV=2 3 244 3.0E-10
sp|O68874|AQPZ_SHIFL Aquaporin Z OS=Shigella flexneri GN=aqpZ PE=3 SV=2 73 230 6.0E-10
sp|P60844|AQPZ_ECOLI Aquaporin Z OS=Escherichia coli (strain K12) GN=aqpZ PE=1 SV=1 73 230 6.0E-10
sp|P60845|AQPZ_ECOL6 Aquaporin Z OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aqpZ PE=3 SV=1 73 230 6.0E-10
sp|Q8X6K6|AQPZ_ECO57 Aquaporin Z OS=Escherichia coli O157:H7 GN=aqpZ PE=3 SV=1 73 230 6.0E-10
sp|Q7N5C1|AQPZ_PHOLL Aquaporin Z OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aqpZ PE=3 SV=1 73 247 1.0E-09
sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1 32 267 2.0E-09
sp|Q9L772|AQPZ_BRUME Aquaporin Z OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=aqpZ PE=3 SV=1 35 239 2.0E-09
sp|Q87MQ5|AQPZ_VIBPA Aquaporin Z OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aqpZ PE=3 SV=1 64 247 2.0E-09
sp|O43315|AQP9_HUMAN Aquaporin-9 OS=Homo sapiens GN=AQP9 PE=2 SV=2 9 247 3.0E-09
sp|Q19KC1|NIP21_MAIZE Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2 32 249 3.0E-09
sp|Q96PS8|AQP10_HUMAN Aquaporin-10 OS=Homo sapiens GN=AQP10 PE=2 SV=2 32 260 4.0E-09
sp|Q9ATN2|NIP22_MAIZE Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1 32 267 7.0E-09
sp|P60925|AQPZ_RHOPA Aquaporin Z OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aqpZ PE=3 SV=1 33 248 2.0E-08
sp|P56627|AQP9_RAT Aquaporin-9 OS=Rattus norvegicus GN=Aqp9 PE=2 SV=1 7 265 3.0E-08
sp|Q9AT74|NIP23_MAIZE Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1 32 251 4.0E-08
sp|Q8UJW4|AQPZ2_AGRFC Aquaporin Z 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aqpZ2 PE=1 SV=1 73 236 8.0E-08
sp|Q8UI24|AQPZ1_AGRFC Aquaporin Z 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aqpZ1 PE=3 SV=1 33 236 1.0E-07
sp|Q67WJ8|NIP22_ORYSJ Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica GN=NIP2-2 PE=2 SV=1 78 249 3.0E-07
sp|P0A3Q8|GLPF_STRR6 Glycerol uptake facilitator protein OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glpF PE=3 SV=1 71 246 1.0E-06
sp|O28846|AQPM_ARCFU Probable aquaporin AqpM OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aqpM PE=1 SV=1 73 247 1.0E-06
sp|Q9JJJ3|AQP9_MOUSE Aquaporin-9 OS=Mus musculus GN=Aqp9 PE=2 SV=1 33 265 1.0E-06
sp|P0A3Q7|GLPF_STRPN Glycerol uptake facilitator protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glpF PE=3 SV=1 71 246 2.0E-06
sp|P31140|GLPF_SHIFL Glycerol uptake facilitator protein OS=Shigella flexneri GN=glpF PE=3 SV=2 66 219 7.0E-06
sp|P0AER0|GLPF_ECOLI Glycerol uptake facilitator protein OS=Escherichia coli (strain K12) GN=glpF PE=1 SV=1 66 219 7.0E-06
sp|P0AER1|GLPF_ECOL6 Glycerol uptake facilitator protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glpF PE=3 SV=1 66 219 7.0E-06
sp|P0AER2|GLPF_ECO57 Glycerol uptake facilitator protein OS=Escherichia coli O157:H7 GN=glpF PE=3 SV=1 66 219 7.0E-06
sp|B7XIC4|AQP_ENTBH Aquaporin OS=Enterocytozoon bieneusi (strain H348) GN=AQP PE=3 SV=1 85 239 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015267 channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 87 22
3 115 137 22
4 157 176 19
5 183 205 22
6 225 247 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3423
MAAGSNPHDPRGPEKGTYYYIPSSARNALIVVIGEFCGTFMFLLISFIAAETAITTNSTDATAPLAPFSIMYIAA
SFGMALAVNVWIFFRVSGGQFNPAVTLGLVLVGAVKPLRALMIVPAQLAAGIAAAAMTFALVPGKLLVESKLAPG
VSVVQGLFMEMFLTSQLVVTVYFLAVEKHRATFLAPLGIGASVFVGHMAGVNFSGASLNPARSFGPAVFLGFVSH
HWVYWIGPFMGALLAFAAYSLLKWLDYQTANPGQDADDLEMQCRGGLPPMMSGTRNMFTSDGIIKISSDHLPSKD
GRPGDFRREGHPLGSQPMGGPGAPYLNVRFSWNKE*
Coding >Hirsu2|3423
ATGGCTGCCGGCTCCAATCCTCACGACCCCCGGGGCCCCGAGAAGGGGACATACTACTACATCCCGAGCTCGGCT
CGCAATGCTCTCATCGTCGTCATCGGCGAGTTCTGCGGAACCTTCATGTTCCTGCTCATCTCCTTCATCGCCGCC
GAAACCGCCATCACGACCAACTCGACCGATGCAACCGCGCCGCTCGCTCCCTTCAGCATCATGTACATCGCCGCC
TCCTTCGGCATGGCTCTTGCCGTCAACGTCTGGATATTCTTCAGGGTCAGCGGAGGCCAATTCAACCCTGCCGTC
ACACTTGGGCTTGTTCTCGTCGGCGCCGTCAAGCCGCTGCGAGCCCTCATGATCGTGCCCGCGCAACTCGCGGCC
GGCATCGCTGCCGCGGCCATGACCTTTGCCCTTGTCCCGGGCAAGCTGCTGGTGGAGAGCAAGCTCGCGCCTGGC
GTCAGCGTCGTCCAGGGCCTCTTCATGGAGATGTTCCTGACCTCGCAACTCGTCGTCACCGTCTACTTCCTGGCC
GTCGAGAAGCATCGGGCCACCTTCCTCGCGCCCCTCGGCATCGGAGCCTCCGTCTTTGTCGGGCACATGGCCGGA
GTCAACTTCTCGGGCGCCTCGCTCAACCCGGCGCGGTCCTTCGGCCCGGCCGTCTTCCTCGGCTTCGTGAGCCAC
CATTGGGTCTACTGGATCGGGCCCTTCATGGGCGCCCTGCTCGCCTTCGCCGCCTACAGCCTCCTCAAGTGGCTG
GACTACCAGACCGCCAACCCGGGACAGGACGCGGACGATCTCGAGATGCAATGCCGCGGAGGCCTACCGCCCATG
ATGAGCGGGACGCGCAACATGTTCACCAGCGACGGCATCATCAAGATCAGCAGCGACCACCTGCCCTCGAAGGAC
GGCCGGCCCGGCGACTTCCGGAGAGAAGGACACCCTCTCGGCAGCCAGCCCATGGGAGGGCCAGGCGCGCCCTAT
CTCAACGTGCGCTTTTCCTGGAATAAGGAGTAG
Transcript >Hirsu2|3423
ATGGCTGCCGGCTCCAATCCTCACGACCCCCGGGGCCCCGAGAAGGGGACATACTACTACATCCCGAGCTCGGCT
CGCAATGCTCTCATCGTCGTCATCGGCGAGTTCTGCGGAACCTTCATGTTCCTGCTCATCTCCTTCATCGCCGCC
GAAACCGCCATCACGACCAACTCGACCGATGCAACCGCGCCGCTCGCTCCCTTCAGCATCATGTACATCGCCGCC
TCCTTCGGCATGGCTCTTGCCGTCAACGTCTGGATATTCTTCAGGGTCAGCGGAGGCCAATTCAACCCTGCCGTC
ACACTTGGGCTTGTTCTCGTCGGCGCCGTCAAGCCGCTGCGAGCCCTCATGATCGTGCCCGCGCAACTCGCGGCC
GGCATCGCTGCCGCGGCCATGACCTTTGCCCTTGTCCCGGGCAAGCTGCTGGTGGAGAGCAAGCTCGCGCCTGGC
GTCAGCGTCGTCCAGGGCCTCTTCATGGAGATGTTCCTGACCTCGCAACTCGTCGTCACCGTCTACTTCCTGGCC
GTCGAGAAGCATCGGGCCACCTTCCTCGCGCCCCTCGGCATCGGAGCCTCCGTCTTTGTCGGGCACATGGCCGGA
GTCAACTTCTCGGGCGCCTCGCTCAACCCGGCGCGGTCCTTCGGCCCGGCCGTCTTCCTCGGCTTCGTGAGCCAC
CATTGGGTCTACTGGATCGGGCCCTTCATGGGCGCCCTGCTCGCCTTCGCCGCCTACAGCCTCCTCAAGTGGCTG
GACTACCAGACCGCCAACCCGGGACAGGACGCGGACGATCTCGAGATGCAATGCCGCGGAGGCCTACCGCCCATG
ATGAGCGGGACGCGCAACATGTTCACCAGCGACGGCATCATCAAGATCAGCAGCGACCACCTGCCCTCGAAGGAC
GGCCGGCCCGGCGACTTCCGGAGAGAAGGACACCCTCTCGGCAGCCAGCCCATGGGAGGGCCAGGCGCGCCCTAT
CTCAACGTGCGCTTTTCCTGGAATAAGGAGTAG
Gene >Hirsu2|3423
ATGGCTGCCGGCTCCAATCCTCACGACCCCCGGGGCCCCGAGAAGGGGACATACTACTACATCCCGAGCTCGGCT
CGCAATGCTCTCATCGTCGTCATCGGCGAGTTCTGCGGAACCTTCATGTTCCTGCTCATCTCCTTCATCGCCGCC
GAAACCGCCATCACGACCAACTCGACCGATGCAACCGCGCCGCTCGCTCCCTTCAGCATCATGTACATCGCCGCC
TCCTTCGGCATGGCTCTTGCCGTCAACGTCTGGATATTCTTCAGGGTCAGCGGAGGCCAATTCAACCCTGCCGTA
AGTCCAGACAAACAGCGCCGCCTCCCGACTCTTCTCTNNNNNNNNNNCCCCCCCCCCCCCTGCCAAGCGTCTTGC
GCCTCAACCCCGTATGCGCCAGCCCGCGGATGCTGACAATCGGTATACAGGTCACACTTGGGCTTGTTCTCGTCG
GCGCCGTCAAGCCGCTGCGAGCCCTCATGATCGTGCCCGCGCAACTCGCGGCCGGCATCGCTGCCGCGGCCATGA
CCTTTGCCCTTGTCCCGGGCAAGCTGCTGGTGGAGAGCAAGCTCGCGCCTGGCGTCAGCGTCGTCCAGGGCCTCT
TCATGGAGATGTTCCTGACCTCGCAACTCGTCGTCACCGTCTACTTCCTGGCCGTCGAGAAGCATCGGGCCACCT
TCCTCGCGCCCCTCGGCATCGGAGCCTCCGTCTTTGTCGGGCACATGGCCGGAGTCAACTTCTCGGGCGCCTCGC
TCAACCCGGCGCGGTCCTTCGGCCCGGCCGTCTTCCTCGGCTTCGTGAGCCACCATTGGGTCTACTGGATCGGGC
CCTTCATGGGCGCCCTGCTCGCCTTCGCCGCCTACAGCCTCCTCAAGTGGCTGGACTACCAGACCGCCAACCCGG
GACAGGACGCGGACGATCTCGAGATGCAATGCCGCGGAGGCCTACCGCCCATGATGAGCGGGACGCGCAACATGT
TCACCAGCGACGGCATCATCAAGATCAGCAGCGACCACCTGCCCTCGAAGGACGGCCGGCCCGGCGACTTCCGGA
GAGAAGGACACCCTCTCGGCAGCCAGCCCATGGGAGGGCCAGGCGCGCCCTATCTCAACGTGCGCTTTTCCTGGA
ATAAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail