Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3409
Gene name
LocationContig_1894:2416..4193
Strand+
Gene length (bp)1777
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00890 FAD_binding_2 FAD binding domain 3.6E-85 5 445
PF01266 DAO FAD dependent oxidoreductase 1.5E-14 4 201
PF12831 FAD_oxidored FAD dependent oxidoreductase 6.1E-09 5 191
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.7E-07 7 50
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.3E-06 4 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 4 468 7.0E-167
sp|P32614|FRDS_YEAST Fumarate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRD1 PE=1 SV=1 5 461 9.0E-105
sp|P21375|OSM1_YEAST Fumarate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSM1 PE=1 SV=3 1 457 1.0E-102
sp|Q9Z4P0|FRD2_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=ifcA PE=1 SV=1 4 466 9.0E-64
sp|P83223|FRDA_SHEON Fumarate reductase flavoprotein subunit OS=Shewanella oneidensis (strain MR-1) GN=SO_0970 PE=1 SV=2 5 462 3.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 4 468 7.0E-167
sp|P32614|FRDS_YEAST Fumarate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRD1 PE=1 SV=1 5 461 9.0E-105
sp|P21375|OSM1_YEAST Fumarate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSM1 PE=1 SV=3 1 457 1.0E-102
sp|Q9Z4P0|FRD2_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=ifcA PE=1 SV=1 4 466 9.0E-64
sp|P83223|FRDA_SHEON Fumarate reductase flavoprotein subunit OS=Shewanella oneidensis (strain MR-1) GN=SO_0970 PE=1 SV=2 5 462 3.0E-51
sp|P0C278|FRDA_SHEFR Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina GN=fccA PE=1 SV=1 15 462 2.0E-48
sp|Q07WU7|FRDA_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=fccA PE=1 SV=2 15 462 3.0E-48
sp|Q8CVD0|URDA_SHEON Urocanate reductase OS=Shewanella oneidensis (strain MR-1) GN=urdA PE=1 SV=1 24 460 3.0E-37
sp|Q97K95|NADB_CLOAB L-aspartate oxidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nadB PE=3 SV=1 5 457 1.0E-26
sp|Q60356|Y033_METJA Uncharacterized FAD-dependent oxidoreductase MJ0033 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0033 PE=3 SV=1 29 463 2.0E-24
sp|O66973|NADB_AQUAE L-aspartate oxidase OS=Aquifex aeolicus (strain VF5) GN=nadB PE=3 SV=1 4 452 4.0E-23
sp|Q8XNE2|NADB_CLOPE L-aspartate oxidase OS=Clostridium perfringens (strain 13 / Type A) GN=nadB PE=3 SV=1 5 305 2.0E-22
sp|D9PU00|TFRA_METTM Fumarate reductase (CoM/CoB) subunit A OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=tfrA PE=1 SV=1 5 460 8.0E-22
sp|Q92R32|NADB_RHIME L-aspartate oxidase OS=Rhizobium meliloti (strain 1021) GN=nadB PE=3 SV=1 5 461 6.0E-21
sp|Q9KPA4|NADB_VIBCH L-aspartate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nadB PE=3 SV=2 5 452 7.0E-21
sp|P44894|FRDA_HAEIN Fumarate reductase flavoprotein subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frdA PE=3 SV=1 189 460 1.0E-20
sp|P00363|FRDA_ECOLI Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) GN=frdA PE=1 SV=3 219 479 8.0E-20
sp|P20922|FRDA_PROVU Fumarate reductase flavoprotein subunit OS=Proteus vulgaris GN=frdA PE=3 SV=1 219 459 8.0E-20
sp|Q8TZL4|NADB_PYRFU L-aspartate oxidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=nadB PE=3 SV=1 4 452 9.0E-20
sp|P74562|NADB_SYNY3 L-aspartate oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadB PE=3 SV=1 5 487 1.0E-19
sp|Q9V2R0|NADB_PYRAB L-aspartate oxidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nadB PE=3 SV=1 7 471 2.0E-19
sp|Q8XWM7|NADB1_RALSO L-aspartate oxidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB1 PE=3 SV=1 5 453 6.0E-19
sp|Q9X8N8|NADB_STRCO L-aspartate oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadB PE=3 SV=1 15 451 7.0E-19
sp|Q8Z4K0|NADB_SALTI L-aspartate oxidase OS=Salmonella typhi GN=nadB PE=3 SV=1 5 456 4.0E-18
sp|Q8ZD80|NADB_YERPE L-aspartate oxidase OS=Yersinia pestis GN=nadB PE=3 SV=2 5 457 4.0E-18
sp|Q8YXJ6|NADB_NOSS1 L-aspartate oxidase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadB PE=3 SV=1 153 465 5.0E-18
sp|O57765|NADB_PYRHO L-aspartate oxidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nadB PE=3 SV=1 1 460 6.0E-18
sp|P10902|NADB_ECOLI L-aspartate oxidase OS=Escherichia coli (strain K12) GN=nadB PE=1 SV=4 5 457 6.0E-18
sp|P31038|SDHA_RICPR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhA PE=3 SV=1 189 463 9.0E-18
sp|Q801S2|SDHAB_XENLA Succinate dehydrogenase [ubiquinone] flavoprotein subunit B, mitochondrial OS=Xenopus laevis GN=sdha-b PE=2 SV=1 189 456 1.0E-17
sp|Q8XA23|NADB_ECO57 L-aspartate oxidase OS=Escherichia coli O157:H7 GN=nadB PE=3 SV=1 5 457 1.0E-17
sp|Q8K2B3|SDHA_MOUSE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus GN=Sdha PE=1 SV=1 189 455 1.0E-17
sp|Q8ZMX9|NADB_SALTY L-aspartate oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadB PE=3 SV=1 5 456 1.0E-17
sp|Q9YHT1|SDHA_CHICK Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Gallus gallus GN=SDHA PE=1 SV=2 189 458 1.0E-17
sp|Q920L2|SDHA_RAT Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Rattus norvegicus GN=Sdha PE=1 SV=1 189 456 2.0E-17
sp|Q5R616|SDHA_PONAB Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Pongo abelii GN=SDHA PE=2 SV=1 189 456 2.0E-17
sp|Q68XN9|SDHA_RICTY Succinate dehydrogenase flavoprotein subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhA PE=3 SV=1 189 463 2.0E-17
sp|P31040|SDHA_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens GN=SDHA PE=1 SV=2 189 455 2.0E-17
sp|Q51363|NADB_PSEAE L-aspartate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadB PE=3 SV=1 5 456 3.0E-17
sp|Q8HXW3|SDHA_MACFA Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Macaca fascicularis GN=SDHA PE=2 SV=1 24 456 4.0E-17
sp|Q7ZVF3|SDHA_DANRE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Danio rerio GN=sdha PE=2 SV=2 24 458 4.0E-17
sp|P31039|SDHA_BOVIN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Bos taurus GN=SDHA PE=1 SV=3 189 456 6.0E-17
sp|Q972D2|NADB_SULTO L-aspartate oxidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=nadB PE=1 SV=1 5 452 8.0E-17
sp|Q09508|SDHA_CAEEL Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Caenorhabditis elegans GN=sdha-1 PE=2 SV=3 189 456 3.0E-16
sp|Q4UJM1|SDHA_RICFE Succinate dehydrogenase flavoprotein subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhA PE=3 SV=1 189 463 3.0E-16
sp|Q92J97|SDHA_RICCN Succinate dehydrogenase flavoprotein subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhA PE=3 SV=1 189 463 4.0E-16
sp|Q28ED0|SDHA_XENTR Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Xenopus tropicalis GN=sdha PE=2 SV=1 189 456 5.0E-16
sp|P47052|SDHX_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL045W PE=3 SV=1 189 463 5.0E-16
sp|Q9K107|NADB_NEIMB L-aspartate oxidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nadB PE=3 SV=1 28 456 6.0E-16
sp|Q1RHB9|SDHA_RICBR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhA PE=3 SV=1 189 463 8.0E-16
sp|Q6PA58|SDHAA_XENLA Succinate dehydrogenase [ubiquinone] flavoprotein subunit A, mitochondrial OS=Xenopus laevis GN=sdha-a PE=2 SV=1 189 456 8.0E-16
sp|Q9JSX4|NADB_NEIMA L-aspartate oxidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nadB PE=3 SV=1 28 456 1.0E-15
sp|Q59661|SDHA_PARDE Succinate dehydrogenase flavoprotein subunit OS=Paracoccus denitrificans GN=sdhA PE=3 SV=1 189 467 1.0E-15
sp|Q9KDJ5|NADB_BACHD L-aspartate oxidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nadB PE=3 SV=1 5 474 2.0E-15
sp|Q94523|SDHA_DROME Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Drosophila melanogaster GN=SdhA PE=2 SV=3 190 458 3.0E-15
sp|P38032|NADB_BACSU L-aspartate oxidase OS=Bacillus subtilis (strain 168) GN=nadB PE=3 SV=1 28 457 4.0E-15
sp|Q8ZQU3|SDHA_SALTY Succinate dehydrogenase flavoprotein subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sdhA PE=3 SV=1 217 456 5.0E-15
sp|Q8XQG4|NADB2_RALSO L-aspartate oxidase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=nadB2 PE=3 SV=1 110 461 7.0E-15
sp|P51054|SDHA_COXBU Succinate dehydrogenase flavoprotein subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sdhA PE=3 SV=1 218 456 9.0E-15
sp|Q8U8J4|NADB_AGRFC L-aspartate oxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nadB PE=3 SV=1 6 459 1.0E-14
sp|Q0QF17|SDHA_MESAU Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (Fragment) OS=Mesocricetus auratus GN=SDHA PE=1 SV=1 189 455 2.0E-14
sp|Q929Z2|NADB_LISIN L-aspartate oxidase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=nadB PE=3 SV=1 4 453 2.0E-14
sp|P0AC41|SDHA_ECOLI Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) GN=sdhA PE=1 SV=1 217 456 2.0E-14
sp|P0AC42|SDHA_ECOL6 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sdhA PE=3 SV=1 217 456 2.0E-14
sp|P0AC43|SDHA_ECO57 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O157:H7 GN=sdhA PE=3 SV=1 217 456 2.0E-14
sp|Q8Y5N4|NADB_LISMO L-aspartate oxidase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=nadB PE=3 SV=1 4 453 1.0E-13
sp|Q9ZPX5|SDHA2_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH1-2 PE=1 SV=1 187 457 2.0E-13
sp|Q6ZDY8|SDHA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH1 PE=1 SV=1 189 472 3.0E-13
sp|Q0QF01|SDHA_PIG Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Sus scrofa GN=SDHA PE=1 SV=2 190 456 8.0E-13
sp|Q9UTJ7|SDHA_SCHPO Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh1 PE=2 SV=1 6 455 8.0E-13
sp|O06913|FRDA_HELPY Fumarate reductase flavoprotein subunit OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=frdA PE=3 SV=2 6 469 8.0E-13
sp|Q9U3X4|SDHA_DICDI Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhA PE=3 SV=1 151 463 1.0E-12
sp|P08065|SDHA_BACSU Succinate dehydrogenase flavoprotein subunit OS=Bacillus subtilis (strain 168) GN=sdhA PE=3 SV=4 5 463 3.0E-12
sp|P17412|FRDA_WOLSU Fumarate reductase flavoprotein subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=frdA PE=1 SV=3 6 457 4.0E-11
sp|O82663|SDHA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH1-1 PE=1 SV=1 189 457 6.0E-11
sp|Q9HNZ0|NADB_HALSA L-aspartate oxidase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=nadB PE=3 SV=1 63 304 7.0E-11
sp|Q49617|NADB_MYCLE L-aspartate oxidase OS=Mycobacterium leprae (strain TN) GN=nadB PE=3 SV=2 2 446 2.0E-10
sp|Q97ZC5|NADB_SULSO L-aspartate oxidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=nadB PE=3 SV=2 5 305 2.0E-10
sp|Q9A4C3|NADB_CAUCR L-aspartate oxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nadB PE=3 SV=1 153 451 4.0E-10
sp|Q94AY1|NADB_ARATH L-aspartate oxidase, chloroplastic OS=Arabidopsis thaliana GN=AO PE=1 SV=1 7 296 3.0E-09
sp|P9WJJ9|NADB_MYCTU L-aspartate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nadB PE=1 SV=1 2 446 4.0E-08
sp|P9WJJ8|NADB_MYCTO L-aspartate oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nadB PE=3 SV=1 2 446 4.0E-08
sp|P65500|NADB_MYCBO L-aspartate oxidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nadB PE=3 SV=1 2 446 4.0E-08
sp|Q00711|SDHA_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH1 PE=1 SV=1 396 463 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3409
MAPRVIVVGGGLSGLSAAHTIYLAGGNVVVLDKQGFFGGNSTKATSGINGALTRTQVDHQIGDSVKQFYDDTLKS
ARDKARPDLIKVLTYKSAAAVEWLQDVFNLDLTLVSRLGGHSQPRTHRGHDAKFPGMAITYALMQRLEELAETEP
HRVEIIKKARVTGLNKDGNKVTGVSYESNGQSASLDGPVVLATGGYAADFGDSSLLKKHRPDTFGLATTNGTHAT
GDGQKMVMAIGGNAIDMDKVQVHPTGLVDPKDPGSKWKFLAAEALRGEGGLLLNADGDRFCDELGHRDYVSGMMW
KEKEKNKFPIRLVLNSKASKVLDFHTRHYSGRGLMRKMTGKELAKEIGCTPDHLQATFKTYNAIADGQKKDPWGK
RFFHNMPLDINDDFHVSLMEPVLHFTMGGIEINDKAQVLNQDQQPFEGLFACGELAGGVHGANRLGGSSLLGCVV
YGRVAGDTASSYLLQQALQGAAAGGGSAAQRLGQISLHLDP*
Coding >Hirsu2|3409
ATGGCACCCAGAGTCATCGTCGTTGGCGGCGGCTTGTCCGGCCTGAGCGCGGCCCACACCATCTATCTGGCCGGC
GGCAACGTCGTCGTCCTCGATAAGCAGGGCTTCTTCGGCGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGC
GCCCTGACGCGCACCCAGGTCGACCACCAGATCGGCGACAGCGTCAAGCAGTTCTACGACGACACGCTCAAGTCG
GCCCGCGACAAGGCCCGACCCGACCTCATCAAGGTCCTCACCTACAAGTCGGCCGCCGCCGTCGAGTGGCTGCAA
GACGTCTTCAACCTCGACCTGACGCTCGTCTCCCGGTTAGGCGGCCATTCTCAGCCCCGGACGCATCGCGGCCAT
GACGCCAAGTTCCCCGGTATGGCCATCACCTACGCCCTGATGCAGCGCCTCGAGGAGCTCGCCGAGACGGAGCCC
CACCGCGTCGAGATCATCAAGAAGGCCCGCGTCACCGGCCTCAACAAGGACGGCAACAAGGTGACGGGCGTCTCG
TACGAGTCCAACGGCCAGTCGGCCTCCCTCGACGGCCCCGTCGTCCTCGCCACCGGAGGTTACGCCGCCGACTTC
GGCGACTCGTCCCTGCTCAAGAAGCACCGCCCGGACACGTTCGGCCTGGCCACCACCAACGGCACCCACGCCACC
GGCGACGGCCAGAAGATGGTCATGGCCATCGGCGGCAACGCCATCGACATGGACAAGGTCCAGGTCCACCCCACC
GGCCTCGTCGACCCCAAGGACCCCGGCTCCAAGTGGAAGTTCCTGGCGGCCGAGGCCCTCCGCGGCGAGGGCGGC
CTGCTGCTCAACGCCGACGGCGACCGCTTCTGCGACGAGCTCGGCCACCGCGACTACGTGTCGGGCATGATGTGG
AAGGAGAAGGAGAAGAACAAGTTCCCCATCCGCCTCGTCCTCAACTCCAAGGCCTCCAAGGTCCTCGACTTCCAC
ACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCCAAGGAGATCGGCTGCACC
CCGGACCACCTGCAGGCCACCTTCAAGACGTACAACGCCATCGCCGACGGCCAGAAGAAGGACCCCTGGGGCAAG
CGCTTCTTCCATAACATGCCGCTCGACATCAACGACGACTTCCACGTCTCGCTCATGGAGCCCGTCCTGCACTTC
ACCATGGGCGGCATCGAGATCAACGACAAGGCCCAGGTCCTCAACCAGGACCAGCAGCCGTTCGAGGGCCTCTTC
GCCTGCGGCGAGCTGGCCGGCGGCGTCCACGGCGCCAACCGCCTCGGCGGCTCCTCGCTGCTGGGCTGCGTCGTC
TACGGCCGCGTCGCCGGCGACACGGCCAGCAGCTATCTACTCCAGCAGGCCCTGCAGGGCGCGGCCGCCGGCGGC
GGGTCGGCCGCCCAGCGGTTGGGCCAGATCTCGCTGCACCTCGACCCCTAG
Transcript >Hirsu2|3409
ATGGCACCCAGAGTCATCGTCGTTGGCGGCGGCTTGTCCGGCCTGAGCGCGGCCCACACCATCTATCTGGCCGGC
GGCAACGTCGTCGTCCTCGATAAGCAGGGCTTCTTCGGCGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGC
GCCCTGACGCGCACCCAGGTCGACCACCAGATCGGCGACAGCGTCAAGCAGTTCTACGACGACACGCTCAAGTCG
GCCCGCGACAAGGCCCGACCCGACCTCATCAAGGTCCTCACCTACAAGTCGGCCGCCGCCGTCGAGTGGCTGCAA
GACGTCTTCAACCTCGACCTGACGCTCGTCTCCCGGTTAGGCGGCCATTCTCAGCCCCGGACGCATCGCGGCCAT
GACGCCAAGTTCCCCGGTATGGCCATCACCTACGCCCTGATGCAGCGCCTCGAGGAGCTCGCCGAGACGGAGCCC
CACCGCGTCGAGATCATCAAGAAGGCCCGCGTCACCGGCCTCAACAAGGACGGCAACAAGGTGACGGGCGTCTCG
TACGAGTCCAACGGCCAGTCGGCCTCCCTCGACGGCCCCGTCGTCCTCGCCACCGGAGGTTACGCCGCCGACTTC
GGCGACTCGTCCCTGCTCAAGAAGCACCGCCCGGACACGTTCGGCCTGGCCACCACCAACGGCACCCACGCCACC
GGCGACGGCCAGAAGATGGTCATGGCCATCGGCGGCAACGCCATCGACATGGACAAGGTCCAGGTCCACCCCACC
GGCCTCGTCGACCCCAAGGACCCCGGCTCCAAGTGGAAGTTCCTGGCGGCCGAGGCCCTCCGCGGCGAGGGCGGC
CTGCTGCTCAACGCCGACGGCGACCGCTTCTGCGACGAGCTCGGCCACCGCGACTACGTGTCGGGCATGATGTGG
AAGGAGAAGGAGAAGAACAAGTTCCCCATCCGCCTCGTCCTCAACTCCAAGGCCTCCAAGGTCCTCGACTTCCAC
ACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCCAAGGAGATCGGCTGCACC
CCGGACCACCTGCAGGCCACCTTCAAGACGTACAACGCCATCGCCGACGGCCAGAAGAAGGACCCCTGGGGCAAG
CGCTTCTTCCATAACATGCCGCTCGACATCAACGACGACTTCCACGTCTCGCTCATGGAGCCCGTCCTGCACTTC
ACCATGGGCGGCATCGAGATCAACGACAAGGCCCAGGTCCTCAACCAGGACCAGCAGCCGTTCGAGGGCCTCTTC
GCCTGCGGCGAGCTGGCCGGCGGCGTCCACGGCGCCAACCGCCTCGGCGGCTCCTCGCTGCTGGGCTGCGTCGTC
TACGGCCGCGTCGCCGGCGACACGGCCAGCAGCTATCTACTCCAGCAGGCCCTGCAGGGCGCGGCCGCCGGCGGC
GGGTCGGCCGCCCAGCGGTTGGGCCAGATCTCGCTGCACCTCGACCCCTAG
Gene >Hirsu2|3409
ATGGCACCCAGAGTCATCGTCGTTGGCGGCGGCTGTGAGTAGCAGCGGCCGCTCCTCGCCTCCGTGGCCGGCTCC
GTTCCCATCGCTGACTCGCCTCCTCTCGCCACAGTGTCCGGCCTGAGCGCGGCCCACACCATCTATCTGGCCGGC
GGCAACGTCGTCGTCCTCGATAAGCAGGGTAAGTCGGCTGCCTGGCGACCGCTCTCTCCTACCCGCCTCGTCCGT
GCCCCGAGAGGAGGAGGACAAGCTGGCGCGCCCCCCGTTGCGGGACATGGTCGGCTTTTCACATGCTGACACGTG
CCCGTTTCCGTCTGCAGGCTTCTTCGGCGGCAACTCGACAAAGGCCACGTCCGGCATCAACGGCGCCCTGACGCG
CACCCAGGTCGACCACCAGATCGGCGACAGCGTCAAGCAGTTCTACGACGACACGCTCAAGTCGGCCCGCGACAA
GGCCCGACCCGACCTCATCAAGGTCCTCACCTACAAGTCGGCCGCCGCCGTCGAGTGGCTGCAAGACGTCTTCAA
CCTCGACCTGACGCTCGTCTCCCGGTTAGGGTGAGTTCTTCCCATCACGTCTCCTCGCCACCGCCGTCTGCACAC
CGCCGGCACCGCGCAACTGACACCAACTGACACGTCCTCCAGCGGCCATTCTCAGCCCCGGACGCATCGCGGCCA
TGACGCCAAGTTCCCCGGTATGGCCATCACCTACGCCCTGATGCAGCGCCTCGAGGAGCTCGCCGAGACGGAGCC
CCACCGCGTCGAGATCATCAAGAAGGCCCGCGTCACCGGCCTCAACAAGGACGGCAACAAGGTGACGGGCGTCTC
GTACGAGTCCAACGGCCAGTCGGCCTCCCTCGACGGCCCCGTCGTCCTCGCCACCGGAGGTTACGCCGCCGACTT
CGGCGACTCGTCCCTGCTCAAGAAGCACCGCCCGGACACGTTCGGCCTGGCCACCACCAACGGCACCCACGCCAC
CGGCGACGGCCAGAAGATGGTCATGGCCATCGGCGGCAACGCCATCGACATGGACAAGGTCCAGGTCCACCCCAC
CGGCCTCGTCGACCCCAAGGACCCCGGCTCCAAGTGGAAGTTCCTGGCGGCCGAGGCCCTCCGCGGCGAGGGCGG
CCTGCTGCTCAACGCCGACGGCGACCGCTTCTGCGACGAGCTCGGCCACCGCGACTACGTGTCGGGCATGATGTG
GAAGGAGAAGGAGAAGAACAAGTTCCCCATCCGCCTCGTCCTCAACTCCAAGGCCTCCAAGGTCCTCGACTTCCA
CACCCGCCACTACTCGGGCCGCGGCCTGATGCGCAAGATGACGGGCAAGGAGCTGGCCAAGGAGATCGGCTGCAC
CCCGGACCACCTGCAGGCCACCTTCAAGACGTACAACGCCATCGCCGACGGCCAGAAGAAGGACCCCTGGGGCAA
GCGCTTCTTCCATAACATGCCGCTCGACATCAACGACGACTTCCACGTCTCGCTCATGGAGCCCGTCCTGCACTT
CACCATGGGCGGCATCGAGATCAACGACAAGGCCCAGGTCCTCAACCAGGACCAGCAGCCGTTCGAGGGCCTCTT
CGCCTGCGGCGAGCTGGCCGGCGGCGTCCACGGCGCCAACCGCCTCGGCGGCTCCTCGCTGCTGGGCTGCGTCGT
CTACGGCCGCGTCGCCGGCGACACGGCCAGCAGCTATCTACTCCAGCAGGCCCTGCAGGGCGCGGCCGCCGGCGG
CGGGTCGGCCGCCCAGCGGTTGGGCCAGATCTCGCTGCACCTCGACCCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail