Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3406
Gene name
LocationContig_1891:1507..3308
Strand-
Gene length (bp)1801
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04091 Sec15 Exocyst complex subunit Sec15-like 3.9E-112 108 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75006|SEC15_SCHPO Exocyst complex component sec15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec15 PE=3 SV=2 4 420 8.0E-47
sp|P22224|SEC15_YEAST Exocyst complex component SEC15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC15 PE=1 SV=2 15 408 6.0E-41
sp|O54923|EXOC6_RAT Exocyst complex component 6 OS=Rattus norvegicus GN=Exoc6 PE=2 SV=2 14 414 2.0E-40
sp|Q8R313|EXOC6_MOUSE Exocyst complex component 6 OS=Mus musculus GN=Exoc6 PE=1 SV=2 11 414 2.0E-40
sp|A6H5Z3|EXC6B_MOUSE Exocyst complex component 6B OS=Mus musculus GN=Exoc6b PE=1 SV=1 13 414 6.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75006|SEC15_SCHPO Exocyst complex component sec15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec15 PE=3 SV=2 4 420 8.0E-47
sp|P22224|SEC15_YEAST Exocyst complex component SEC15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC15 PE=1 SV=2 15 408 6.0E-41
sp|O54923|EXOC6_RAT Exocyst complex component 6 OS=Rattus norvegicus GN=Exoc6 PE=2 SV=2 14 414 2.0E-40
sp|Q8R313|EXOC6_MOUSE Exocyst complex component 6 OS=Mus musculus GN=Exoc6 PE=1 SV=2 11 414 2.0E-40
sp|A6H5Z3|EXC6B_MOUSE Exocyst complex component 6B OS=Mus musculus GN=Exoc6b PE=1 SV=1 13 414 6.0E-39
sp|Q9Y2D4|EXC6B_HUMAN Exocyst complex component 6B OS=Homo sapiens GN=EXOC6B PE=1 SV=3 13 414 7.0E-39
sp|E2R766|EXOC6_CANLF Exocyst complex component 6 OS=Canis lupus familiaris GN=EXOC6 PE=3 SV=1 14 414 3.0E-38
sp|Q8TAG9|EXOC6_HUMAN Exocyst complex component 6 OS=Homo sapiens GN=EXOC6 PE=1 SV=3 14 414 2.0E-37
sp|Q18286|EXOC6_CAEEL Exocyst complex component 6 OS=Caenorhabditis elegans GN=sec-15 PE=3 SV=4 6 408 3.0E-32
sp|F4JHH5|SC15B_ARATH Exocyst complex component SEC15B OS=Arabidopsis thaliana GN=SEC15B PE=1 SV=1 1 397 2.0E-29
sp|Q9VDE6|EXOC6_DROME Exocyst complex component 6 OS=Drosophila melanogaster GN=Sec15 PE=1 SV=1 13 414 1.0E-27
sp|Q9LXX6|SC15A_ARATH Exocyst complex component SEC15A OS=Arabidopsis thaliana GN=SEC15A PE=3 SV=2 10 429 1.0E-26
sp|Q54B27|EXOC6_DICDI Exocyst complex component 6 OS=Dictyostelium discoideum GN=exoc6 PE=3 SV=1 13 405 2.0E-18
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Signal peptide 0.6126 0.2569 0.4713 0.2291 0.0922 0.0053 0.1864 0.364 0.6157 0.0083

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5126
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1034
Ophiocordyceps australis map64 (Brazil) OphauB2|5025
Ophiocordyceps camponoti-floridani Ophcf2|04267
Ophiocordyceps camponoti-rufipedis Ophun1|344
Ophiocordyceps kimflemingae Ophio5|8493
Ophiocordyceps subramaniannii Hirsu2|3406 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3406
MRRVPHLRPAVDVEELWESMCSAAMALTSRAIDEVKNAESLLKIKGYIALFIQTMEGWGYSVATLDTFLLTLFDK
YAELLKRRFSEDFQEIVSTDDYMPMAINSLEEYEKVINVSWFIQDQPTEELSFPCVLPFSQMYPLCCIDIRNFLN
QFYFFSDDHFQHSDVIDDTLKKSLDELLIEKVCKSLVERLSSQYLGQIVQILINLEQFEIACQELEQLLIRARSS
TSAGGSLKLNATEEFRNNKKNAEKRIFELVNSKIDDLVDTAEYDWLATTVTTEPSNYMQTLTRYLSNIMNSTLLG
LPREIKELIYFDALSHAANKILALPLSSEVEHINAHGVSALAQDVQYLTEFVSCLENGQMLRENLDELQQTINLM
QSDNADEFFDISTRNKKYGRVDALNGPLLLEKLTPTGGKTAPLSNLSSRFAMMK*
Coding >Hirsu2|3406
ATGCGTCGTGTTCCACACTTGCGCCCTGCTGTCGATGTGGAGGAGCTTTGGGAATCCATGTGTAGTGCTGCTATG
GCGTTGACGTCAAGGGCGATTGACGAAGTGAAGAACGCGGAGAGCCTGCTCAAGATCAAGGGATATATCGCCCTG
TTCATACAGACTATGGAGGGCTGGGGATACTCTGTCGCAACGTTGGACACATTCCTTCTCACTTTATTCGACAAA
TATGCTGAGCTCTTGAAGCGACGGTTCAGCGAGGACTTTCAAGAAATTGTCTCAACTGATGATTACATGCCTATG
GCTATCAACTCCCTCGAAGAATACGAGAAAGTTATCAATGTTAGTTGGTTCATTCAAGATCAGCCGACTGAAGAA
CTCTCCTTTCCTTGTGTCCTGCCCTTCTCGCAGATGTACCCCTTGTGTTGTATCGATATCAGAAATTTCCTGAAC
CAATTCTACTTTTTTTCTGACGATCACTTTCAACACTCTGATGTCATAGATGACACTCTGAAAAAGTCTCTGGAC
GAACTTCTCATAGAGAAAGTCTGCAAATCGTTGGTCGAGCGTCTCAGTTCCCAGTACCTCGGTCAAATTGTCCAG
ATTCTCATAAACCTTGAGCAGTTCGAAATTGCGTGTCAAGAGCTGGAACAACTATTGATCAGAGCCAGATCATCC
ACATCGGCCGGGGGGTCGCTGAAACTGAACGCCACTGAGGAATTTCGCAATAATAAAAAAAATGCCGAAAAACGG
ATATTCGAACTCGTCAACAGCAAGATAGATGACCTAGTTGATACGGCCGAGTATGATTGGCTGGCCACTACTGTG
ACGACGGAGCCTAGCAATTATATGCAGACCTTGACACGTTATCTCTCGAACATCATGAATTCGACTTTGCTTGGT
CTGCCGCGTGAGATCAAAGAGCTGATCTATTTCGATGCTTTGAGTCATGCTGCCAATAAAATATTGGCTCTCCCT
CTGTCCTCAGAAGTCGAACATATCAACGCACATGGAGTCTCAGCGCTGGCCCAAGATGTGCAATACTTGACTGAA
TTTGTCAGCTGCCTCGAGAACGGGCAGATGTTGAGGGAGAATCTAGACGAACTGCAGCAGACAATAAATCTAATG
CAATCAGACAACGCAGACGAGTTTTTCGATATATCTACTCGGAACAAGAAGTATGGGCGAGTCGATGCTCTCAAT
GGACCTCTTTTACTGGAAAAACTCACGCCTACAGGGGGCAAAACTGCGCCCTTGTCCAATCTCTCATCGCGATTC
GCCATGATGAAGTGA
Transcript >Hirsu2|3406
ATGCGTCGTGTTCCACACTTGCGCCCTGCTGTCGATGTGGAGGAGCTTTGGGAATCCATGTGTAGTGCTGCTATG
GCGTTGACGTCAAGGGCGATTGACGAAGTGAAGAACGCGGAGAGCCTGCTCAAGATCAAGGGATATATCGCCCTG
TTCATACAGACTATGGAGGGCTGGGGATACTCTGTCGCAACGTTGGACACATTCCTTCTCACTTTATTCGACAAA
TATGCTGAGCTCTTGAAGCGACGGTTCAGCGAGGACTTTCAAGAAATTGTCTCAACTGATGATTACATGCCTATG
GCTATCAACTCCCTCGAAGAATACGAGAAAGTTATCAATGTTAGTTGGTTCATTCAAGATCAGCCGACTGAAGAA
CTCTCCTTTCCTTGTGTCCTGCCCTTCTCGCAGATGTACCCCTTGTGTTGTATCGATATCAGAAATTTCCTGAAC
CAATTCTACTTTTTTTCTGACGATCACTTTCAACACTCTGATGTCATAGATGACACTCTGAAAAAGTCTCTGGAC
GAACTTCTCATAGAGAAAGTCTGCAAATCGTTGGTCGAGCGTCTCAGTTCCCAGTACCTCGGTCAAATTGTCCAG
ATTCTCATAAACCTTGAGCAGTTCGAAATTGCGTGTCAAGAGCTGGAACAACTATTGATCAGAGCCAGATCATCC
ACATCGGCCGGGGGGTCGCTGAAACTGAACGCCACTGAGGAATTTCGCAATAATAAAAAAAATGCCGAAAAACGG
ATATTCGAACTCGTCAACAGCAAGATAGATGACCTAGTTGATACGGCCGAGTATGATTGGCTGGCCACTACTGTG
ACGACGGAGCCTAGCAATTATATGCAGACCTTGACACGTTATCTCTCGAACATCATGAATTCGACTTTGCTTGGT
CTGCCGCGTGAGATCAAAGAGCTGATCTATTTCGATGCTTTGAGTCATGCTGCCAATAAAATATTGGCTCTCCCT
CTGTCCTCAGAAGTCGAACATATCAACGCACATGGAGTCTCAGCGCTGGCCCAAGATGTGCAATACTTGACTGAA
TTTGTCAGCTGCCTCGAGAACGGGCAGATGTTGAGGGAGAATCTAGACGAACTGCAGCAGACAATAAATCTAATG
CAATCAGACAACGCAGACGAGTTTTTCGATATATCTACTCGGAACAAGAAGTATGGGCGAGTCGATGCTCTCAAT
GGACCTCTTTTACTGGAAAAACTCACGCCTACAGGGGGCAAAACTGCGCCCTTGTCCAATCTCTCATCGCGATTC
GCCATGATGAAGTGA
Gene >Hirsu2|3406
ATGCGTCGTGTTCCACACTTGCGCCCTGCTGTCGATGTATAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNCCCTTTCCCTTCATTTTTGATTTTCAAATAAATCGAGAGATTGATGCCTGAAATTGGCTAATT
CAGTCGACGGATCTCCAGGTGGAGGAGCTTTGGGAATCCATGTGTAGTGCTGCTATGGCGTTGACGTCAAGGGCG
ATTGACGAAGTGAAGAACGCGGAGAGCCTGCTCAAGATCAAGGGATATATCGCCCTGTTCATACAGACTATGGAG
GTACGCCATGGGATTAATAAACATCGACGCAGATCATCGCTTAGTATATCCAGGGCTGGGGATACTCTGTCGCAA
CGTTGGACACATTCCTTCTCACTTTATTCGACAAATATGCTGAGCTCTTGAAGCGACGGTTCAGCGAGGACTTTC
AAGAAGTTTGCTATGCCCGCCCAGAAACCTGGACCGCAGCTCATTTCTGATGGATGTTCAGATTGTCTCAACTGA
TGATTACATGCCTATGGCTATCAACTCCCTCGAAGAATACGAGAAAGTTATCAATGTTAGTTGGTTCATTCAAGA
TCAGCCGACTGAAGAACTCTCGTACGTACCGATGATCAATGATCCCGCAGATAGCTGATAACAGACAGCTTTCCT
TGTGTCCTGCCCTTCTCGCAGATGTACCCCTTGTGTTGTATCGATATCAGAAATTTCCTGAACCAATTCTACTTT
TTTTCTGACGATCACTTTCAACACTCTGATGTCATAGATGACACTCTGAAAAAGGCAAGTGCATACTGGGATCAG
GAAAGGAATTCAGCAGCTGCTGAGATGCTAACACTTACTAAAGTCTCTGGACGAACTTCTCATAGAGAAAGTCTG
CAAATCGTTGGTCGAGCGTCTCAGTTCCCAGTACCTCGGTCAAATTGTCCAGATTCTCATAAACCTTGAGCAGTT
CGAAATTGCGTGTCAAGAGCTGGAACAACTATTGATCAGAGCCAGATCATCCACATCGGCCGGGGGGTCGCTGAA
ACTGAACGCCACTGAGGAATTTCGCAATAATAAAAAAAATGCCGAAAAACGGATATTCGAACTCGTCAACAGCAA
GATAGATGACCTAGTTGATACGGCCGAGTATGATTGGTAGGCTGAAACATTTTCGCCCCTTAGCCCCAGCGGCTG
CTGACAGGAACGTAAGGCTGGCCACTACTGTGACGACGGAGCCTAGCAATTATATGCAGACCTTGACACGTTATC
TCTCGAACATCATGAATTCGACTTTGCTTGGTCTGCCGCGTGAGATCAAAGAGCTGATCTATTTCGATGCTTTGA
GTCATGCTGCCAATAAAATATTGGTTTGTTCACTTTGCTGACCTCAGTCGCCAATGTCAGGCTGACATGCGACGC
AGGCTCTCCCTCTGTCCTCAGAAGTCGAACATATCAACGCACATGGAGTCTCAGCGCTGGCCCAAGATGTGCAAT
ACTTGACTGAATTTGTCAGCTGCCTCGAGAACGGGCAGATGTTGAGGGAGAATCTAGACGAACTGCAGCAGACAA
TAAATCTAATGCAATCAGACAACGCAGACGAGTTTTTCGATATATCTACTCGGAACAAGAAGTATGGGCGAGTCG
ATGCTCTCAATGGACCTCTTTTACTGGAAAAGTATGCTCGATGTCACAAGGAGATATTCAGTCCTAACTGAAGCG
CCGCAGACTCACGCCTACAGGGGGCAAAACTGCGCCCTTGTCCAATCTCTCATCGCGATTCGCCATGATGAAGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail