Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3404
Gene name
LocationContig_1890:1444..4278
Strand+
Gene length (bp)2834
Transcript length (bp)2691
Coding sequence length (bp)2691
Protein length (aa) 897

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain 2.8E-57 329 476
PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain 3.5E-53 124 300
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 2.3E-31 646 751
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.5E-25 771 880
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.7E-21 545 615

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 17 896 0.0E+00
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 12 896 0.0E+00
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 13 896 0.0E+00
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 24 896 0.0E+00
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 63 896 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 17 896 0.0E+00
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 12 896 0.0E+00
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 13 896 0.0E+00
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 24 896 0.0E+00
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 63 896 0.0E+00
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 63 896 0.0E+00
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta GN=YNR1 PE=1 SV=1 71 881 0.0E+00
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 41 896 0.0E+00
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 68 896 0.0E+00
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 75 896 0.0E+00
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 68 896 0.0E+00
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 75 896 0.0E+00
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 73 896 0.0E+00
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 75 896 0.0E+00
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 73 896 0.0E+00
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 75 888 0.0E+00
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 75 895 0.0E+00
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 75 896 0.0E+00
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 68 896 0.0E+00
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 68 896 0.0E+00
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 5 888 0.0E+00
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 68 895 0.0E+00
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 68 888 0.0E+00
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 68 895 0.0E+00
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 75 888 0.0E+00
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 73 896 0.0E+00
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 70 896 0.0E+00
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 68 896 0.0E+00
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 73 896 0.0E+00
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 73 875 0.0E+00
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 75 878 0.0E+00
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 58 896 2.0E-173
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 267 895 4.0E-131
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 291 615 9.0E-57
sp|Q9S850|SUOX_ARATH Sulfite oxidase OS=Arabidopsis thaliana GN=SOX PE=1 SV=1 90 474 7.0E-50
sp|Q60HD0|SUOX_MACFA Sulfite oxidase, mitochondrial OS=Macaca fascicularis GN=SUOX PE=2 SV=3 90 474 5.0E-48
sp|Q9VWP4|SUOX_DROME Probable sulfite oxidase, mitochondrial OS=Drosophila melanogaster GN=CG7280 PE=2 SV=1 78 474 5.0E-48
sp|P07850|SUOX_CHICK Sulfite oxidase OS=Gallus gallus GN=SUOX PE=1 SV=3 90 471 1.0E-47
sp|Q07116|SUOX_RAT Sulfite oxidase, mitochondrial OS=Rattus norvegicus GN=Suox PE=1 SV=2 73 475 2.0E-47
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapiens GN=SUOX PE=1 SV=2 90 475 3.0E-47
sp|Q8R086|SUOX_MOUSE Sulfite oxidase, mitochondrial OS=Mus musculus GN=Suox PE=1 SV=2 90 475 7.0E-47
sp|Q0X0E5|NB5R3_CANLF NADH-cytochrome b5 reductase 3 OS=Canis lupus familiaris GN=CYB5R3 PE=1 SV=1 648 896 2.0E-43
sp|P00387|NB5R3_HUMAN NADH-cytochrome b5 reductase 3 OS=Homo sapiens GN=CYB5R3 PE=1 SV=3 648 896 4.0E-43
sp|P83686|NB5R3_PIG NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus scrofa GN=CYB5R3 PE=1 SV=1 648 896 5.0E-43
sp|P07514|NB5R3_BOVIN NADH-cytochrome b5 reductase 3 OS=Bos taurus GN=CYB5R3 PE=1 SV=3 648 896 1.0E-42
sp|Q9DCN2|NB5R3_MOUSE NADH-cytochrome b5 reductase 3 OS=Mus musculus GN=Cyb5r3 PE=1 SV=3 648 896 4.0E-42
sp|Q60HG4|NB5R3_MACFA NADH-cytochrome b5 reductase 3 OS=Macaca fascicularis GN=CYB5R3 PE=2 SV=3 648 896 4.0E-42
sp|Q5ZHX7|NB5R2_CHICK NADH-cytochrome b5 reductase 2 OS=Gallus gallus GN=CYB5R2 PE=2 SV=1 648 896 5.0E-42
sp|Q9UHQ9|NB5R1_HUMAN NADH-cytochrome b5 reductase 1 OS=Homo sapiens GN=CYB5R1 PE=1 SV=1 648 896 9.0E-42
sp|Q5PQA4|NB5R2_XENLA NADH-cytochrome b5 reductase 2 OS=Xenopus laevis GN=cyb5r2 PE=2 SV=1 648 896 9.0E-42
sp|P20070|NB5R3_RAT NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus GN=Cyb5r3 PE=1 SV=2 648 896 1.0E-41
sp|Q3MHW9|NB5R1_BOVIN NADH-cytochrome b5 reductase 1 OS=Bos taurus GN=CYB5R1 PE=2 SV=1 648 896 2.0E-41
sp|Q0P487|NB5R2_DANRE NADH-cytochrome b5 reductase 2 OS=Danio rerio GN=cyb5r2 PE=2 SV=2 648 896 6.0E-41
sp|Q54NC1|NCB5R_DICDI NADH-cytochrome b5 reductase 1 OS=Dictyostelium discoideum GN=cyb5r1 PE=3 SV=1 648 896 1.0E-40
sp|Q9DB73|NB5R1_MOUSE NADH-cytochrome b5 reductase 1 OS=Mus musculus GN=Cyb5r1 PE=1 SV=1 648 896 2.0E-40
sp|Q5EB81|NB5R1_RAT NADH-cytochrome b5 reductase 1 OS=Rattus norvegicus GN=Cyb5r1 PE=2 SV=1 648 896 5.0E-40
sp|Q5BJ68|NB5R2_XENTR NADH-cytochrome b5 reductase 2 OS=Xenopus tropicalis GN=cyb5r2 PE=2 SV=1 648 896 1.0E-39
sp|Q3KNK3|NB5R2_MOUSE NADH-cytochrome b5 reductase 2 OS=Mus musculus GN=Cyb5r2 PE=2 SV=2 648 896 3.0E-38
sp|Q6AY12|NB5R2_RAT NADH-cytochrome b5 reductase 2 OS=Rattus norvegicus GN=Cyb5r2 PE=2 SV=1 648 896 5.0E-37
sp|Q6BCY4|NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens GN=CYB5R2 PE=1 SV=1 648 896 3.0E-35
sp|B0CQN7|NCB5R_LACBS NADH-cytochrome b5 reductase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MCR1.1 PE=3 SV=1 643 896 5.0E-35
sp|P0CP14|NCB5R_CRYNJ NADH-cytochrome b5 reductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CBR1 PE=3 SV=1 642 889 1.0E-32
sp|P0CP15|NCB5R_CRYNB NADH-cytochrome b5 reductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CBR1 PE=3 SV=1 642 889 1.0E-32
sp|A5DQ25|NCB5R_PICGU NADH-cytochrome b5 reductase 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CBR1 PE=3 SV=1 643 896 1.0E-32
sp|Q6BUX2|NCB5R_DEBHA NADH-cytochrome b5 reductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBR1 PE=3 SV=1 643 888 3.0E-32
sp|O74557|NCB5R_SCHPO NADH-cytochrome b5 reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbr1 PE=3 SV=1 638 896 3.0E-32
sp|A7TNL7|NCB5R_VANPO NADH-cytochrome b5 reductase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CBR1 PE=3 SV=1 657 896 8.0E-32
sp|Q1DWN4|NCB5R_COCIM NADH-cytochrome b5 reductase 1 OS=Coccidioides immitis (strain RS) GN=CBR1 PE=3 SV=1 647 893 3.0E-31
sp|Q0U9W5|MCR1_PHANO NADH-cytochrome b5 reductase 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MCR1 PE=3 SV=1 617 896 6.0E-31
sp|A4QR21|MCR1_MAGO7 NADH-cytochrome b5 reductase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MCR1 PE=3 SV=1 648 896 2.0E-30
sp|P83291|NB5R2_ARATH NADH-cytochrome b5 reductase-like protein OS=Arabidopsis thaliana GN=CBR2 PE=1 SV=2 610 896 2.0E-30
sp|A5E7U2|NCB5R_LODEL NADH-cytochrome b5 reductase 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CBR1 PE=3 SV=1 638 888 4.0E-30
sp|A6SI59|MCR1_BOTFB NADH-cytochrome b5 reductase 2 OS=Botryotinia fuckeliana (strain B05.10) GN=mcr1 PE=3 SV=1 653 896 7.0E-30
sp|Q0CY37|NCB5R_ASPTN NADH-cytochrome b5 reductase 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbr1 PE=3 SV=1 632 888 1.0E-29
sp|Q12746|PGA3_YEAST Plasma membrane-associated coenzyme Q6 reductase PGA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGA3 PE=1 SV=1 633 896 1.0E-29
sp|Q7SFY2|MCR1_NEUCR NADH-cytochrome b5 reductase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcr-1 PE=3 SV=1 643 885 2.0E-29
sp|Q4PGW7|NCB5R_USTMA NADH-cytochrome b5 reductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CBR1 PE=3 SV=1 642 888 3.0E-29
sp|Q04516|AIM33_YEAST Uncharacterized oxidoreductase AIM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM33 PE=1 SV=1 635 896 3.0E-29
sp|P38626|NCB5R_YEAST NADH-cytochrome b5 reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBR1 PE=1 SV=2 630 888 4.0E-29
sp|Q7RXL1|NCB5R_NEUCR NADH-cytochrome b5 reductase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbr1 PE=3 SV=1 648 888 5.0E-29
sp|Q9ZNT1|NB5R1_ARATH NADH--cytochrome b5 reductase 1 OS=Arabidopsis thaliana GN=CBR1 PE=1 SV=1 633 896 5.0E-29
sp|Q6CA86|NCB5R_YARLI NADH-cytochrome b5 reductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBR1 PE=3 SV=1 648 888 6.0E-29
sp|A7EKT5|MCR1_SCLS1 NADH-cytochrome b5 reductase 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mcr1 PE=3 SV=1 654 896 1.0E-28
sp|Q59P03|NCB5R_CANAL NADH-cytochrome b5 reductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBR1 PE=3 SV=1 642 888 2.0E-28
sp|A5DQE4|MCR1_PICGU NADH-cytochrome b5 reductase 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MCR1 PE=3 SV=2 636 879 2.0E-28
sp|A6ZVM6|NCB5R_YEAS7 NADH-cytochrome b5 reductase 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CBR1 PE=3 SV=2 630 888 2.0E-28
sp|Q0UEY4|NCB5R_PHANO NADH-cytochrome b5 reductase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CBR1 PE=3 SV=2 648 888 2.0E-28
sp|Q5AZB4|NCB5R_EMENI NADH-cytochrome b5 reductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbr1 PE=3 SV=2 632 888 2.0E-28
sp|A6R2K7|NCB5R_AJECN NADH-cytochrome b5 reductase 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CBR1 PE=3 SV=1 648 888 3.0E-28
sp|Q2UKB8|MCR1_ASPOR NADH-cytochrome b5 reductase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcr1 PE=3 SV=1 643 896 3.0E-28
sp|A1CRK9|MCR1_ASPCL NADH-cytochrome b5 reductase 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mcr1 PE=3 SV=1 643 879 4.0E-28
sp|A3GF86|NCB5R_PICST NADH-cytochrome b5 reductase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CBR1 PE=3 SV=2 648 896 4.0E-28
sp|A2Q898|MCR1_ASPNC NADH-cytochrome b5 reductase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mcr1 PE=3 SV=1 643 896 5.0E-28
sp|Q2UFN3|NCB5R_ASPOR NADH-cytochrome b5 reductase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cbr1 PE=3 SV=2 643 888 7.0E-28
sp|Q6FLT3|NCB5R_CANGA NADH-cytochrome b5 reductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBR1 PE=3 SV=1 638 896 8.0E-28
sp|A1D4H0|MCR1_NEOFI NADH-cytochrome b5 reductase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mcr1 PE=3 SV=1 643 879 1.0E-27
sp|Q9UR35|NCB5R_MORAP NADH-cytochrome b5 reductase 1 OS=Mortierella alpina GN=CBR1 PE=2 SV=1 642 888 2.0E-27
sp|A2QCV4|NCB5R_ASPNC NADH-cytochrome b5 reductase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbr1 PE=3 SV=1 648 888 3.0E-27
sp|Q4X0B5|NCB5R_ASPFU NADH-cytochrome b5 reductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbr1 PE=3 SV=2 642 888 4.0E-27
sp|Q75AL4|NCB5R_ASHGO NADH-cytochrome b5 reductase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBR1 PE=3 SV=1 643 888 4.0E-27
sp|A1DHW1|NCB5R_NEOFI NADH-cytochrome b5 reductase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbr1 PE=3 SV=2 642 888 5.0E-27
sp|A4R935|NCB5R_MAGO7 NADH-cytochrome b5 reductase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CBR1 PE=3 SV=1 648 888 7.0E-27
sp|A1C7E9|NCB5R_ASPCL NADH-cytochrome b5 reductase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbr1 PE=3 SV=1 631 888 8.0E-27
sp|P39871|NIA2_MAIZE Nitrate reductase [NAD(P)H] (Fragment) OS=Zea mays GN=NAR PE=2 SV=1 670 896 1.0E-26
sp|Q1DXN1|MCR1_COCIM NADH-cytochrome b5 reductase 2 OS=Coccidioides immitis (strain RS) GN=MCR1 PE=3 SV=2 643 879 2.0E-26
sp|Q5BG98|MCR1_EMENI NADH-cytochrome b5 reductase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcr1 PE=3 SV=1 643 896 8.0E-26
sp|Q0CRD8|MCR1_ASPTN NADH-cytochrome b5 reductase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mcr1 PE=3 SV=2 643 896 1.0E-25
sp|Q6CID0|NCB5R_KLULA NADH-cytochrome b5 reductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBR1 PE=3 SV=1 651 888 2.0E-25
sp|Q4WJW8|MCR1_ASPFU NADH-cytochrome b5 reductase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mcr1 PE=3 SV=1 643 879 8.0E-25
sp|Q6BQ54|MCR1_DEBHA NADH-cytochrome b5 reductase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCR1 PE=3 SV=1 636 896 2.0E-24
sp|Q6C9G8|MCR1_YARLI NADH-cytochrome b5 reductase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCR1 PE=3 SV=1 631 896 3.0E-24
sp|Q2HG02|MCR1_CHAGB NADH-cytochrome b5 reductase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCR1 PE=3 SV=1 643 896 5.0E-24
sp|A6R1T7|MCR1_AJECN NADH-cytochrome b5 reductase 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MCR1 PE=3 SV=1 653 896 1.0E-23
sp|A3LT66|MCR1_PICST NADH-cytochrome b5 reductase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MCR1 PE=3 SV=2 643 879 2.0E-23
sp|A5E5C5|MCR1_LODEL NADH-cytochrome b5 reductase 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MCR1 PE=3 SV=1 636 896 1.0E-22
sp|A7THS1|MCR1A_VANPO NADH-cytochrome b5 reductase 2-A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MCR1A PE=3 SV=1 637 884 2.0E-22
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 628 872 7.0E-22
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 643 896 2.0E-21
sp|Q75C62|MCR1_ASHGO NADH-cytochrome b5 reductase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCR1 PE=3 SV=1 618 872 3.0E-21
sp|Q59M70|MCR1_CANAL NADH-cytochrome b5 reductase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCR1 PE=3 SV=1 636 896 7.0E-21
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 632 872 4.0E-20
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 632 872 7.0E-20
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 628 872 8.0E-20
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 643 896 3.0E-19
sp|P39882|NIA_LOTTE Nitrate reductase [NADH] (Fragment) OS=Lotus tetragonolobus GN=NIA PE=2 SV=1 743 896 5.0E-19
sp|Q4P7Y8|MCR1_USTMA NADH-cytochrome b5 reductase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MCR1 PE=3 SV=1 691 872 5.0E-19
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 542 617 3.0E-17
sp|Q6CS27|MCR1_KLULA NADH-cytochrome b5 reductase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCR1 PE=3 SV=1 637 878 5.0E-17
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 542 616 1.0E-16
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 542 617 5.0E-16
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 542 617 5.0E-16
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 540 616 6.0E-16
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 542 616 7.0E-16
sp|A6ZZH2|MCR1_YEAS7 NADH-cytochrome b5 reductase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=MCR1 PE=3 SV=1 655 885 7.0E-16
sp|A7TM72|MCR1B_VANPO NADH-cytochrome b5 reductase 2-B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MCR1B PE=3 SV=1 654 894 7.0E-16
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 542 616 2.0E-15
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 542 617 2.0E-15
sp|P36060|MCR1_YEAST NADH-cytochrome b5 reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCR1 PE=1 SV=1 655 885 4.0E-15
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 542 617 5.0E-15
sp|Q6FUX5|MCR1_CANGA NADH-cytochrome b5 reductase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCR1 PE=3 SV=1 620 896 9.0E-15
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 542 615 9.0E-14
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 541 615 1.0E-13
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 544 616 5.0E-13
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 542 617 5.0E-13
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 542 615 2.0E-12
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 538 618 2.0E-12
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 542 616 8.0E-12
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 545 615 1.0E-11
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 538 618 1.0E-11
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 538 618 1.0E-11
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 538 618 1.0E-11
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 535 622 2.0E-11
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 538 624 2.0E-11
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 542 618 3.0E-11
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 538 618 3.0E-11
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 545 618 7.0E-11
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 546 636 9.0E-11
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 538 618 1.0E-10
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 542 618 2.0E-10
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 542 616 2.0E-10
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 546 636 2.0E-10
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 544 646 4.0E-10
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 546 615 4.0E-10
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 546 615 5.0E-10
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 541 615 2.0E-09
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 544 621 6.0E-09
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 542 612 6.0E-09
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 544 621 1.0E-08
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 544 615 1.0E-08
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 545 615 1.0E-08
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 544 615 2.0E-08
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 547 615 2.0E-08
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 542 615 2.0E-08
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 542 622 2.0E-08
sp|P0A4R1|YEDY_BRUSU Sulfoxide reductase catalytic subunit YedY OS=Brucella suis biovar 1 (strain 1330) GN=yedY PE=3 SV=1 73 319 3.0E-08
sp|P0A4R0|YEDY_BRUME Sulfoxide reductase catalytic subunit YedY OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=yedY PE=3 SV=1 73 319 3.0E-08
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 544 621 4.0E-08
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 535 612 4.0E-08
sp|Q8XV50|YEDY_RALSO Sulfoxide reductase catalytic subunit YedY OS=Ralstonia solanacearum (strain GMI1000) GN=yedY PE=3 SV=1 97 319 6.0E-08
sp|O32103|YUIH_BACSU Uncharacterized oxidoreductase YuiH OS=Bacillus subtilis (strain 168) GN=yuiH PE=3 SV=1 121 294 1.0E-07
sp|Q6IPT4|NB5R5_HUMAN NADH-cytochrome b5 reductase-like OS=Homo sapiens GN=CYB5RL PE=2 SV=3 654 896 1.0E-07
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 540 610 1.0E-07
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 542 633 2.0E-07
sp|P58770|YEDY_AGRFC Sulfoxide reductase catalytic subunit YedY OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=yedY PE=3 SV=1 86 354 2.0E-07
sp|Q9HVA4|YEDY_PSEAE Sulfoxide reductase catalytic subunit YedY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=yedY PE=3 SV=1 97 305 3.0E-07
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 538 615 4.0E-07
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 542 615 5.0E-07
sp|Q888N2|YEDY_PSESM Sulfoxide reductase catalytic subunit YedY OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=yedY PE=3 SV=1 138 305 5.0E-07
sp|Q5LNE0|YEDY_RUEPO Sulfoxide reductase catalytic subunit YedY OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=yedY PE=3 SV=1 113 319 5.0E-07
sp|B2VGX7|YEDY_ERWT9 Sulfoxide reductase catalytic subunit YedY OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=yedY PE=3 SV=1 137 305 7.0E-07
sp|Q9A4T2|YEDY_CAUCR Sulfoxide reductase catalytic subunit YedY OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=yedY PE=3 SV=2 138 381 8.0E-07
sp|A6VQE0|YEDY_ACTSZ Sulfoxide reductase catalytic subunit YedY OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=yedY PE=3 SV=1 138 320 9.0E-07
sp|Q0I4C9|YEDY_HAES1 Sulfoxide reductase catalytic subunit YedY OS=Haemophilus somnus (strain 129Pt) GN=yedY PE=3 SV=1 97 320 1.0E-06
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 542 617 1.0E-06
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 544 615 2.0E-06
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 545 697 2.0E-06
sp|B3PWV0|YEDY_RHIE6 Sulfoxide reductase catalytic subunit YedY OS=Rhizobium etli (strain CIAT 652) GN=yedY PE=3 SV=1 138 319 2.0E-06
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 541 615 3.0E-06
sp|B7USY1|YEDY_ECO27 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=yedY PE=3 SV=1 138 319 3.0E-06
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 542 635 3.0E-06
sp|B7LRM8|YEDY_ESCF3 Sulfoxide reductase catalytic subunit YedY OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|P67347|YEDY_SALTY Sulfoxide reductase catalytic subunit YedY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|P67348|YEDY_SALTI Sulfoxide reductase catalytic subunit YedY OS=Salmonella typhi GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|B5BGT1|YEDY_SALPK Sulfoxide reductase catalytic subunit YedY OS=Salmonella paratyphi A (strain AKU_12601) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|A9N876|YEDY_SALPB Sulfoxide reductase catalytic subunit YedY OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|Q5PJV7|YEDY_SALPA Sulfoxide reductase catalytic subunit YedY OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|B4SUN2|YEDY_SALNS Sulfoxide reductase catalytic subunit YedY OS=Salmonella newport (strain SL254) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|B4TJV1|YEDY_SALHS Sulfoxide reductase catalytic subunit YedY OS=Salmonella heidelberg (strain SL476) GN=yedY PE=3 SV=1 138 319 4.0E-06
sp|Q32HK5|YEDY_SHIDS Sulfoxide reductase catalytic subunit YedY OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=yedY PE=3 SV=1 138 319 5.0E-06
sp|B4TX85|YEDY_SALSV Sulfoxide reductase catalytic subunit YedY OS=Salmonella schwarzengrund (strain CVM19633) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|Q57J91|YEDY_SALCH Sulfoxide reductase catalytic subunit YedY OS=Salmonella choleraesuis (strain SC-B67) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B5F7N7|YEDY_SALA4 Sulfoxide reductase catalytic subunit YedY OS=Salmonella agona (strain SL483) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|C4ZQP1|YEDY_ECOBW Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B7NBW2|YEDY_ECOLU Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B5REX5|YEDY_SALG2 Sulfoxide reductase catalytic subunit YedY OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B5R1C0|YEDY_SALEP Sulfoxide reductase catalytic subunit YedY OS=Salmonella enteritidis PT4 (strain P125109) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B5FIV5|YEDY_SALDC Sulfoxide reductase catalytic subunit YedY OS=Salmonella dublin (strain CT_02021853) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|P76342|YEDY_ECOLI Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain K12) GN=yedY PE=1 SV=1 138 319 6.0E-06
sp|B7L8Y8|YEDY_ECO55 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain 55989 / EAEC) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B1IZU1|YEDY_ECOLC Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|B7MWF7|YEDY_ECO81 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O81 (strain ED1a) GN=yedY PE=3 SV=1 138 319 6.0E-06
sp|Q3Z0L8|YEDY_SHISS Sulfoxide reductase catalytic subunit YedY OS=Shigella sonnei (strain Ss046) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B5YSJ7|YEDY_ECO5E Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|Q8XB74|YEDY_ECO57 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O157:H7 GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B2TWL4|YEDY_SHIB3 Sulfoxide reductase catalytic subunit YedY OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B1LQN8|YEDY_ECOSM Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B7NRB1|YEDY_ECO7I Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B6I116|YEDY_ECOSE Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain SE11) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|Q8FGI7|YEDY_ECOL6 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|B7M3A9|YEDY_ECO8A Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O8 (strain IAI1) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|A7ZN92|YEDY_ECO24 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|A8A1H0|YEDY_ECOHS Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O9:H4 (strain HS) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|A9MNV7|YEDY_SALAR Sulfoxide reductase catalytic subunit YedY OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=yedY PE=3 SV=1 138 319 7.0E-06
sp|Q1RAH1|YEDY_ECOUT Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli (strain UTI89 / UPEC) GN=yedY PE=3 SV=1 138 319 8.0E-06
sp|A1ACB6|YEDY_ECOK1 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O1:K1 / APEC GN=yedY PE=3 SV=1 138 319 8.0E-06
sp|B7MCM4|YEDY_ECO45 Sulfoxide reductase catalytic subunit YedY OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=yedY PE=3 SV=1 138 319 8.0E-06
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 529 618 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0042128 nitrate assimilation Yes
GO:0030151 molybdenum ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0071941 nitrogen cycle metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0043436 oxoacid metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:0006082 organic acid metabolic process No
GO:2001057 reactive nitrogen species metabolic process No
GO:0003824 catalytic activity No
GO:0042126 nitrate metabolic process No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3404
MIHQPVAGSIFHPPVDTIPPTPPVSARSSRSGSADQVSKRAPSDLPSTTFQIYPSSEPFYPQPPHPGPKSVLPVD
QKTPDSHVERDERLVRLTGSHPFNAEAPLNELYDEGFITSENLHYVRNHGPVPRCEDGDAFDWVFTVEGMVAQPL
TLSLKDLLDSHEQLTYPVTLVCAGNRRKEQNVVRKTKGFSWGPAGLSTALWTGTPISDLLIRAGPLQGAKYVCFE
GADKLPNGCYGTSVKLSLCMDAQKGILVAHRMNGRMLQPDHGKPVRVVVPGQIGGRSVKWLKRILVTAEPSDNWY
HIYDNRVLPTIVTPEASAADMLEMWKDERYAIYSLNTNSAICYPAHDEVITLRSRTETYKVQGYAYSGGGKRVTR
MEVTLDRGKCWRLANVHYPEDRYRLAPTGEKLCGGSLDVWRRESSFCWCFWEIDVSVADLETSSDIMARGMDEDL
MVQPRDMYWNVLGMMNNPWMRVVIHKEEQALRFEHPTQPGLMRGGWMTRVKEAGGNLTNGLWGETFSDDMRESQP
CWKEENEVCMTDDKIDRTITVEELMEHTEKANPWFVVNGHVYDATPFLEEHPGGEASILSIAGKDATDDFMAIHS
ENAKALMPKYHIGRLDNDVAVSLSGEENDCDPRRDTFLVSHRWTRAVLRDKFSVSADTKIFRFELHHPGQTVGLP
VGQHLMIRLRNPATRKTIIRSYTPISQGTDQGVLDLLIKIYHETSDKAGGKMTPALDSVPIGCAVDMKGPTGDFQ
YLGKGLCAISGTRRRVRRFNMICAGSGVTPIFQVLRALSKDPQDPTECVLLNGNRTEDDILCRSQLKSLVDSAGH
RCRLLHTLTNPSASWLGRRGRIDRALIEAQIGSREKGVDDMVLVCGPQTLQRSVRNDLKCMGWPDTDVFVF*
Coding >Hirsu2|3404
ATGATTCATCAACCTGTCGCGGGGTCAATCTTTCACCCTCCTGTTGACACCATTCCACCAACTCCCCCAGTATCG
GCAAGGTCGTCTCGGAGTGGCAGTGCCGATCAGGTATCGAAGCGGGCGCCATCCGACTTGCCGTCAACCACCTTC
CAGATCTACCCTTCATCAGAGCCATTCTATCCACAGCCCCCCCATCCTGGCCCCAAGTCAGTTCTTCCCGTGGAC
CAGAAGACACCTGACAGCCATGTCGAGCGAGACGAACGACTTGTCCGTCTCACCGGGTCCCATCCATTCAACGCG
GAGGCTCCGCTGAACGAGCTATATGATGAAGGCTTCATCACTAGCGAGAATCTCCACTACGTACGCAATCACGGG
CCCGTACCAAGGTGTGAGGACGGCGACGCCTTCGATTGGGTCTTCACGGTGGAGGGCATGGTTGCTCAGCCCCTG
ACGCTCAGCTTGAAGGATCTGCTTGACAGTCACGAGCAATTAACCTACCCTGTAACGTTGGTTTGTGCGGGAAAC
CGACGAAAAGAACAAAATGTGGTGAGAAAGACCAAGGGTTTCTCCTGGGGTCCTGCCGGCCTGTCCACGGCCCTG
TGGACTGGAACCCCAATCAGCGACTTACTTATCCGAGCGGGTCCATTGCAGGGTGCGAAATACGTCTGCTTCGAA
GGAGCAGACAAATTACCCAACGGCTGCTACGGAACCTCCGTCAAACTCAGCTTGTGCATGGATGCGCAAAAAGGC
ATACTTGTGGCTCACAGAATGAATGGCCGTATGCTTCAACCAGACCACGGGAAACCTGTCCGTGTCGTCGTCCCT
GGCCAGATAGGCGGACGCAGCGTTAAGTGGCTCAAAAGAATTCTTGTCACGGCTGAACCCAGCGACAACTGGTAT
CACATTTACGATAACCGCGTTCTCCCCACCATTGTGACCCCGGAAGCAAGCGCCGCTGACATGCTGGAGATGTGG
AAAGACGAGAGGTATGCGATATACAGTCTTAACACAAACAGCGCCATCTGCTACCCGGCACACGACGAGGTCATA
ACCCTGAGGAGCAGAACAGAAACATACAAAGTGCAAGGATATGCGTATAGCGGCGGAGGGAAACGCGTTACAAGA
ATGGAAGTCACCCTAGACAGGGGCAAGTGTTGGAGGTTGGCCAACGTTCACTACCCTGAAGACAGATATCGGCTT
GCGCCCACGGGCGAGAAGCTATGCGGTGGCAGCTTGGACGTTTGGCGGAGAGAAAGCAGCTTTTGCTGGTGCTTC
TGGGAAATCGACGTCAGCGTGGCCGACCTGGAGACATCCAGCGACATCATGGCCCGGGGCATGGATGAAGATCTC
ATGGTACAGCCCCGGGATATGTACTGGAACGTTTTGGGTATGATGAATAATCCGTGGATGAGGGTTGTTATACAT
AAAGAGGAGCAGGCTTTGCGGTTTGAACATCCCACTCAACCTGGTCTCATGCGCGGCGGCTGGATGACGAGAGTC
AAGGAAGCCGGTGGTAACCTCACAAATGGGTTGTGGGGCGAGACATTTTCAGACGACATGAGAGAGAGTCAACCA
TGTTGGAAAGAGGAAAACGAGGTTTGCATGACTGACGACAAAATTGATCGGACAATCACCGTCGAAGAGCTTATG
GAGCATACGGAAAAGGCTAATCCGTGGTTTGTTGTCAATGGCCATGTATACGACGCGACACCTTTTCTGGAGGAG
CACCCTGGTGGCGAAGCATCCATACTTAGTATTGCAGGGAAAGATGCGACCGACGACTTCATGGCTATCCACAGC
GAAAACGCCAAAGCTCTGATGCCGAAGTATCATATTGGACGGCTCGACAACGATGTGGCGGTCAGTTTGTCAGGT
GAGGAAAATGATTGCGACCCCAGACGGGATACCTTCCTAGTATCGCACAGGTGGACCAGGGCAGTGTTGCGAGAC
AAGTTCAGTGTGTCAGCAGATACAAAGATTTTTCGCTTCGAGCTCCATCATCCAGGTCAGACAGTAGGTCTGCCG
GTCGGTCAACACTTGATGATACGTCTTCGCAACCCGGCCACGCGGAAGACCATCATCCGCTCATACACGCCAATT
TCTCAGGGGACGGACCAGGGCGTCCTGGATCTGCTCATCAAAATCTACCACGAAACCTCGGACAAGGCGGGCGGC
AAGATGACTCCAGCCTTGGACTCGGTCCCCATAGGCTGCGCTGTTGACATGAAGGGACCAACAGGTGACTTTCAA
TACCTCGGCAAAGGTCTCTGCGCCATATCCGGGACACGACGCAGAGTCCGACGCTTCAACATGATATGTGCCGGC
TCTGGGGTCACACCTATCTTCCAAGTCCTGCGTGCGCTGTCCAAAGACCCGCAAGATCCGACAGAGTGTGTTCTG
CTGAATGGGAACCGTACTGAGGACGATATTCTCTGTCGATCGCAGCTGAAGAGTCTCGTTGATTCAGCTGGGCAT
AGGTGTCGGTTGCTGCACACTCTCACGAACCCGTCGGCCTCCTGGCTGGGACGCAGAGGTCGGATAGACAGGGCC
CTGATTGAAGCACAGATTGGCTCCCGCGAGAAAGGGGTAGATGACATGGTTCTTGTCTGTGGACCCCAAACATTG
CAAAGGAGCGTTCGCAATGATCTCAAATGTATGGGTTGGCCAGACACGGACGTCTTTGTTTTTTAA
Transcript >Hirsu2|3404
ATGATTCATCAACCTGTCGCGGGGTCAATCTTTCACCCTCCTGTTGACACCATTCCACCAACTCCCCCAGTATCG
GCAAGGTCGTCTCGGAGTGGCAGTGCCGATCAGGTATCGAAGCGGGCGCCATCCGACTTGCCGTCAACCACCTTC
CAGATCTACCCTTCATCAGAGCCATTCTATCCACAGCCCCCCCATCCTGGCCCCAAGTCAGTTCTTCCCGTGGAC
CAGAAGACACCTGACAGCCATGTCGAGCGAGACGAACGACTTGTCCGTCTCACCGGGTCCCATCCATTCAACGCG
GAGGCTCCGCTGAACGAGCTATATGATGAAGGCTTCATCACTAGCGAGAATCTCCACTACGTACGCAATCACGGG
CCCGTACCAAGGTGTGAGGACGGCGACGCCTTCGATTGGGTCTTCACGGTGGAGGGCATGGTTGCTCAGCCCCTG
ACGCTCAGCTTGAAGGATCTGCTTGACAGTCACGAGCAATTAACCTACCCTGTAACGTTGGTTTGTGCGGGAAAC
CGACGAAAAGAACAAAATGTGGTGAGAAAGACCAAGGGTTTCTCCTGGGGTCCTGCCGGCCTGTCCACGGCCCTG
TGGACTGGAACCCCAATCAGCGACTTACTTATCCGAGCGGGTCCATTGCAGGGTGCGAAATACGTCTGCTTCGAA
GGAGCAGACAAATTACCCAACGGCTGCTACGGAACCTCCGTCAAACTCAGCTTGTGCATGGATGCGCAAAAAGGC
ATACTTGTGGCTCACAGAATGAATGGCCGTATGCTTCAACCAGACCACGGGAAACCTGTCCGTGTCGTCGTCCCT
GGCCAGATAGGCGGACGCAGCGTTAAGTGGCTCAAAAGAATTCTTGTCACGGCTGAACCCAGCGACAACTGGTAT
CACATTTACGATAACCGCGTTCTCCCCACCATTGTGACCCCGGAAGCAAGCGCCGCTGACATGCTGGAGATGTGG
AAAGACGAGAGGTATGCGATATACAGTCTTAACACAAACAGCGCCATCTGCTACCCGGCACACGACGAGGTCATA
ACCCTGAGGAGCAGAACAGAAACATACAAAGTGCAAGGATATGCGTATAGCGGCGGAGGGAAACGCGTTACAAGA
ATGGAAGTCACCCTAGACAGGGGCAAGTGTTGGAGGTTGGCCAACGTTCACTACCCTGAAGACAGATATCGGCTT
GCGCCCACGGGCGAGAAGCTATGCGGTGGCAGCTTGGACGTTTGGCGGAGAGAAAGCAGCTTTTGCTGGTGCTTC
TGGGAAATCGACGTCAGCGTGGCCGACCTGGAGACATCCAGCGACATCATGGCCCGGGGCATGGATGAAGATCTC
ATGGTACAGCCCCGGGATATGTACTGGAACGTTTTGGGTATGATGAATAATCCGTGGATGAGGGTTGTTATACAT
AAAGAGGAGCAGGCTTTGCGGTTTGAACATCCCACTCAACCTGGTCTCATGCGCGGCGGCTGGATGACGAGAGTC
AAGGAAGCCGGTGGTAACCTCACAAATGGGTTGTGGGGCGAGACATTTTCAGACGACATGAGAGAGAGTCAACCA
TGTTGGAAAGAGGAAAACGAGGTTTGCATGACTGACGACAAAATTGATCGGACAATCACCGTCGAAGAGCTTATG
GAGCATACGGAAAAGGCTAATCCGTGGTTTGTTGTCAATGGCCATGTATACGACGCGACACCTTTTCTGGAGGAG
CACCCTGGTGGCGAAGCATCCATACTTAGTATTGCAGGGAAAGATGCGACCGACGACTTCATGGCTATCCACAGC
GAAAACGCCAAAGCTCTGATGCCGAAGTATCATATTGGACGGCTCGACAACGATGTGGCGGTCAGTTTGTCAGGT
GAGGAAAATGATTGCGACCCCAGACGGGATACCTTCCTAGTATCGCACAGGTGGACCAGGGCAGTGTTGCGAGAC
AAGTTCAGTGTGTCAGCAGATACAAAGATTTTTCGCTTCGAGCTCCATCATCCAGGTCAGACAGTAGGTCTGCCG
GTCGGTCAACACTTGATGATACGTCTTCGCAACCCGGCCACGCGGAAGACCATCATCCGCTCATACACGCCAATT
TCTCAGGGGACGGACCAGGGCGTCCTGGATCTGCTCATCAAAATCTACCACGAAACCTCGGACAAGGCGGGCGGC
AAGATGACTCCAGCCTTGGACTCGGTCCCCATAGGCTGCGCTGTTGACATGAAGGGACCAACAGGTGACTTTCAA
TACCTCGGCAAAGGTCTCTGCGCCATATCCGGGACACGACGCAGAGTCCGACGCTTCAACATGATATGTGCCGGC
TCTGGGGTCACACCTATCTTCCAAGTCCTGCGTGCGCTGTCCAAAGACCCGCAAGATCCGACAGAGTGTGTTCTG
CTGAATGGGAACCGTACTGAGGACGATATTCTCTGTCGATCGCAGCTGAAGAGTCTCGTTGATTCAGCTGGGCAT
AGGTGTCGGTTGCTGCACACTCTCACGAACCCGTCGGCCTCCTGGCTGGGACGCAGAGGTCGGATAGACAGGGCC
CTGATTGAAGCACAGATTGGCTCCCGCGAGAAAGGGGTAGATGACATGGTTCTTGTCTGTGGACCCCAAACATTG
CAAAGGAGCGTTCGCAATGATCTCAAATGTATGGGTTGGCCAGACACGGACGTCTTTGTTTTTTAA
Gene >Hirsu2|3404
ATGATTCATCAACCTGTCGCGGGGTCAATCTTTCACCCTCCTGTTGACACCATTCCACCAACTCCCCCAGTATCG
GCAAGGTCGTCTCGGAGTGGCAGTGCCGATCAGGTATCGAAGCGGGCGCCATCCGACTTGCCGTCAACCACCTTC
CAGATCTACCCTTCATCAGAGCCATTCTATCCACAGCCCCCCCATCCTGGCCCCAAGTCAGTTCTTCCCGTGGAC
CAGAAGACACCTGACAGCCATGTCGAGCGAGACGAACGACTTGTCCGTCTCACCGGGTCCCATCCATTCAACGCG
GAGGCTCCGCTGAACGAGCTATATGATGAAGGCTTCATCACTAGCGAGAATCTCCACTACGTACGCAATCACGGG
CCCGTACCAAGGTGTGAGGACGGCGACGCCTTCGATTGGGTCTTCACGGTGGAGGGCATGGTTGCTCAGCCCCTG
ACGCTCAGCTTGAAGGATCTGCTTGACAGTCACGAGCAATTAACCTACCCTGTAACGTTGGTTTGTGCGGGAAAC
CGACGAAAAGAACAAAATGTGGTGAGAAAGACCAAGGGTTTCTCCTGGGGTCCTGCCGGCCTGTCCACGGCCCTG
TGGACTGGAACCCCAATCAGCGACTTACTTATCCGAGCGGGTCCATTGCAGGGTGCGAAATACGTCTGCTTCGAA
GGAGCAGACAAATTACCCAACGGCTGCTACGGAACCTCCGTCAAACTCAGCTTGTGCATGGATGCGCAAAAAGGC
ATACTTGTGGCTCACAGAATGAATGGCCGTATGCTTCAACCAGACCACGGGAAACCTGTCCGTGTCGTCGTCCCT
GGCCAGATAGGCGGACGCAGCGTTAAGTGGCTCAAAAGAATTCTTGTCACGGCTGAACCCAGCGACAACTGGTAT
CACATTTACGATAACCGCGTTCTCCCCACCATTGTGACCCCGGAAGCAAGCGCCGCTGACATGCTGGAGATGTGG
AAAGACGAGAGGTATGCGATATACAGTCTTAACACAAACAGCGCCATCTGCTACCCGGCACACGACGAGGTCATA
ACCCTGAGGAGCAGAACAGAAACATACAAAGTGCAAGGATATGCGTATAGCGGCGGAGGGAAACGCGTTACAAGA
ATGGAAGTCACCCTAGACAGGGGCAAGTGTTGGAGGTTGGCCAACGTTCACTACCCTGAAGACAGATATCGGCTT
GCGCCCACGGGCGAGAAGCTATGCGGTGGCAGCTTGGACGTTTGGCGGAGAGAAAGCAGCTTTTGCTGGTGCTTC
TGGGAAATCGACGTCAGCGTGGCCGACCTGGAGACATCCAGCGACATCATGGCCCGGGGCATGGATGAAGATCTC
ATGGTACAGCCCCGGGATATGTACTGGAACGTTTTGGGTATGATGAATAATCCGTGGATGAGGGTTGTTATACAT
AAAGAGGAGCAGGCTTTGCGGTTTGAACATCCCACTCAACCTGGTCTCATGCGCGGCGGCTGGATGACGAGAGTC
AAGGAAGCCGGTGGTAACCTCACAAATGGGTTGTGGGGCGAGACATTTTCAGACGACATGAGAGAGAGTCAACCA
TGTTGGAAAGAGGAAAACGAGGTTTGCATGACTGACGACAAAATTGATCGGACAATCACCGTCGAAGAGCTTATG
GAGCATACGGAAAAGGCTAATCCGTGGTTTGTTGTCAATGGCCATGTATACGACGCGACACCTTTTCTGGAGGAG
CACCCTGGTGGCGAAGCATCCATACTTAGTATTGCAGGGAAAGATGCGACCGACGACTTCATGGCTATCCGTTGG
TCTCCCCCCTCCGCCCCACCCCTCCCACTTCCCTTCATCCCCTCACCTGTCACTTTCTTTTCTTCTGGCATCGGC
GTGACGCACGTTACAGCTGTCAGTCGGCAACATTCCAGCTTGAGCTGACAAAGGAGCATTCAGACAGCGAAAACG
CCAAAGCTCTGATGCCGAAGTATCATATTGGACGGCTCGACAACGATGTGGCGGTCAGTTTGTCAGGTGAGGAAA
ATGATTGCGACCCCAGACGGGATACCTTCCTAGTATCGCACAGGTGGACCAGGGCAGTGTTGCGAGACAAGTTCA
GTGTGTCAGCAGATACAAAGATTTTTCGCTTCGAGCTCCATCATCCAGGTCAGACAGTAGGTCTGCCGGTCGGTC
AACACTTGATGATACGTCTTCGCAACCCGGCCACGCGGAAGACCATCATCCGCTCATACACGCCAATTTCTCAGG
GGACGGACCAGGGCGTCCTGGATCTGCTCATCAAAATCTACCACGAAACCTCGGACAAGGCGGGCGGCAAGATGA
CTCCAGCCTTGGACTCGGTCCCCATAGGCTGCGCTGTTGACATGAAGGGACCAACAGGTGACTTTCAATACCTCG
GCAAAGGTCTCTGCGCCATATCCGGGACACGACGCAGAGTCCGACGCTTCAACATGATATGTGCCGGCTCTGGGG
TCACACCTATCTTCCAAGTCCTGCGTGCGCTGTCCAAAGACCCGCAAGATCCGACAGAGTGTGTTCTGCTGAATG
GGAACCGTACTGAGGACGATATTCTCTGTCGATCGCAGCTGAAGAGTCTCGTTGATTCAGCTGGGCATAGGTGTC
GGTTGCTGCACACTCTCACGAACCCGTCGGCCTCCTGGCTGGGACGCAGAGGTCGGATAGACAGGGCCCTGATTG
AAGCACAGATTGGCTCCCGCGAGAAAGGGGTAGATGACATGGTTCTTGTCTGTGGACCCCAAACATTGCAAAGGA
GCGTTCGCAATGATCTCAAATGTATGGGTTGGCCAGACACGGACGTCTTTGTTTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail