Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3400
Gene name
LocationContig_189:1110..1885
Strand-
Gene length (bp)775
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.9E-13 11 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7SFN5|PALI_NEUCR pH-response regulator protein palI/prr-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-5 PE=3 SV=2 13 211 3.0E-14
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 47 211 6.0E-10

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 109 131 22
3 136 158 22
4 173 195 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3400
MGFGTFVHHIGTLLLLVATALLIVVDVTSPVVNRLAIMRVELGNAVEGTDVTFGSFGFCHRGVRDSDRCSHTQIG
YDPAGLMRSIDGTDFGDAAQSTSRGLTRVMILHPVATALCFIAFLLCIGTGIVGSIGAAFFSLLSFIVTVVAMIC
DFVAFSIIKNNVNDNNRSRAYWSSGIWCMLAAALCTLLAAAVVLLTCCAGRSKKRREAEAKGSFSEGTTPAPRRP
FWKRG*
Coding >Hirsu2|3400
ATGGGCTTCGGCACCTTCGTCCACCACATCGGCACGCTGCTGCTCCTGGTCGCTACGGCGCTCCTCATCGTCGTC
GATGTCACCTCGCCGGTGGTGAACAGGCTGGCCATCATGCGGGTCGAGCTGGGCAATGCGGTCGAGGGAACGGAC
GTGACATTTGGATCATTTGGCTTTTGCCATCGCGGAGTCAGGGACTCGGACCGGTGCTCCCACACGCAAATCGGA
TACGACCCGGCCGGCCTGATGCGAAGCATCGACGGCACAGACTTTGGCGACGCGGCGCAGAGCACGTCGAGAGGG
CTCACGCGCGTCATGATCCTACACCCGGTGGCGACGGCGCTGTGCTTCATCGCCTTTCTGCTGTGCATCGGCACC
GGCATCGTCGGCTCGATCGGGGCGGCCTTCTTCTCGCTCCTGTCCTTCATCGTGACGGTGGTGGCCATGATCTGC
GACTTTGTCGCGTTCAGCATCATCAAGAACAACGTCAACGACAACAACCGCAGCAGGGCGTACTGGTCGTCGGGC
ATCTGGTGCATGCTGGCAGCGGCCCTCTGCACGCTGCTCGCCGCCGCCGTCGTCCTGCTGACCTGCTGCGCCGGC
CGATCCAAGAAGCGGCGCGAGGCCGAGGCCAAGGGGTCGTTCAGCGAGGGCACCACCCCCGCCCCCCGACGCCCC
TTCTGGAAACGAGGCTAG
Transcript >Hirsu2|3400
ATGGGCTTCGGCACCTTCGTCCACCACATCGGCACGCTGCTGCTCCTGGTCGCTACGGCGCTCCTCATCGTCGTC
GATGTCACCTCGCCGGTGGTGAACAGGCTGGCCATCATGCGGGTCGAGCTGGGCAATGCGGTCGAGGGAACGGAC
GTGACATTTGGATCATTTGGCTTTTGCCATCGCGGAGTCAGGGACTCGGACCGGTGCTCCCACACGCAAATCGGA
TACGACCCGGCCGGCCTGATGCGAAGCATCGACGGCACAGACTTTGGCGACGCGGCGCAGAGCACGTCGAGAGGG
CTCACGCGCGTCATGATCCTACACCCGGTGGCGACGGCGCTGTGCTTCATCGCCTTTCTGCTGTGCATCGGCACC
GGCATCGTCGGCTCGATCGGGGCGGCCTTCTTCTCGCTCCTGTCCTTCATCGTGACGGTGGTGGCCATGATCTGC
GACTTTGTCGCGTTCAGCATCATCAAGAACAACGTCAACGACAACAACCGCAGCAGGGCGTACTGGTCGTCGGGC
ATCTGGTGCATGCTGGCAGCGGCCCTCTGCACGCTGCTCGCCGCCGCCGTCGTCCTGCTGACCTGCTGCGCCGGC
CGATCCAAGAAGCGGCGCGAGGCCGAGGCCAAGGGGTCGTTCAGCGAGGGCACCACCCCCGCCCCCCGACGCCCC
TTCTGGAAACGAGGCTAG
Gene >Hirsu2|3400
ATGGGCTTCGGCACCTTCGTCCACCACATCGGCACGCTGCTGCTCCTGGTCGCTACGGCGCTCCTCATCGTCGTC
GATGTCACCTCGCCGGTGGTGAACAGGCTGGCCATCATGCGGGTCGAGCTGGGCAATGCGGTCGAGGGAACGGAC
GTGACATTTGGATCATTTGGCTTTTGCCATCGCGGAGTCAGGTAAGCAGCATCATGTGCGCCCTGTTGTCACCGT
TTTGCAGCGTGGGATCCAGTCGAAATGTTGACGCGGGTCCTACCGCAGGGACTCGGACCGGTGCTCCCACACGCA
AATCGGATACGACCCGGCCGGCCTGATGCGAAGCATCGACGGCACAGACTTTGGCGACGCGGCGCAGAGCACGTC
GAGAGGGCTCACGCGCGTCATGATCCTACACCCGGTGGCGACGGCGCTGTGCTTCATCGCCTTTCTGCTGTGCAT
CGGCACCGGCATCGTCGGCTCGATCGGGGCGGCCTTCTTCTCGCTCCTGTCCTTCATCGTGACGGTGGTGGCCAT
GATCTGCGACTTTGTCGCGTTCAGCATCATCAAGAACAACGTCAACGACAACAACCGCAGCAGGGCGTACTGGTC
GTCGGGCATCTGGTGCATGCTGGCAGCGGCCCTCTGCACGCTGCTCGCCGCCGCCGTCGTCCTGCTGACCTGCTG
CGCCGGCCGATCCAAGAAGCGGCGCGAGGCCGAGGCCAAGGGGTCGTTCAGCGAGGGCACCACCCCCGCCCCCCG
ACGCCCCTTCTGGAAACGAGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail