Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3396
Gene name
LocationContig_1887:2002..3156
Strand+
Gene length (bp)1154
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08551 DUF1751 Eukaryotic integral membrane protein (DUF1751) 6.4E-28 48 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LF05|RBL19_ARATH Rhomboid-like protein 19 OS=Arabidopsis thaliana GN=RBL19 PE=2 SV=1 41 305 2.0E-25
sp|Q12239|TM115_YEAST Transmembrane protein 115 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL107W PE=1 SV=1 42 304 6.0E-22
sp|Q12893|TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1 56 305 9.0E-22
sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus GN=TMEM115 PE=2 SV=1 56 305 3.0E-21
sp|Q9WUH1|TM115_MOUSE Transmembrane protein 115 OS=Mus musculus GN=Tmem115 PE=1 SV=1 56 332 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LF05|RBL19_ARATH Rhomboid-like protein 19 OS=Arabidopsis thaliana GN=RBL19 PE=2 SV=1 41 305 2.0E-25
sp|Q12239|TM115_YEAST Transmembrane protein 115 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL107W PE=1 SV=1 42 304 6.0E-22
sp|Q12893|TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1 56 305 9.0E-22
sp|A4FUB8|TM115_BOVIN Transmembrane protein 115 OS=Bos taurus GN=TMEM115 PE=2 SV=1 56 305 3.0E-21
sp|Q9WUH1|TM115_MOUSE Transmembrane protein 115 OS=Mus musculus GN=Tmem115 PE=1 SV=1 56 332 1.0E-20
sp|O42826|PDH1_SCHPO Protein pdh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdh1 PE=3 SV=1 11 147 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0031224 intrinsic component of membrane No
GO:0048193 Golgi vesicle transport No
GO:0016192 vesicle-mediated transport No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Golgi apparatus Signal peptide|Transmembrane domain 0.1013 0.1026 0.0089 0.1512 0.3257 0.0872 0.7856 0.295 0.8046 0.0698

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 30 17
2 54 76 22
3 97 119 22
4 134 156 22
5 168 190 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2402
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|953
Ophiocordyceps australis map64 (Brazil) OphauB2|3262
Ophiocordyceps camponoti-floridani Ophcf2|06657
Ophiocordyceps camponoti-rufipedis Ophun1|6039
Ophiocordyceps kimflemingae Ophio5|5305
Ophiocordyceps subramaniannii Hirsu2|3396 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3396
MPPRINIPPFTRAVLVALVFQSVLSAAIRYRQWTGHADIIIPYLTLVPQLSLGYPWTLLTTTLVEGNVFTLAIAA
VTLYHGGRYLERAWSSAELAKFIALVSLLPNVLTFGVMTLFFALTRNESWTLAVISGTVSIQVSFLVAFSQLVPA
HTVTLFRGILSLRVPRFPLLYIGIVTVLSLTPLLSRAAVWLAVFGFLTSWTYLRFYKSVFPDLDSSQPASLRGDA
SETFAFAEFFPGPVKPLVSAFADQVFDVLVALRLCTPFSQADMSAARGERFLQRGTPGSARAEAERRRAIALKAL
DQRLNAATANAALKQASQPPAQPVGPTVQTQPQPSTQTAMTSQPGPILGETKFEPDDDEDQAEKS*
Coding >Hirsu2|3396
ATGCCTCCGCGAATAAACATCCCGCCCTTCACCCGCGCCGTCCTCGTCGCCCTCGTCTTCCAGTCTGTCCTCAGC
GCCGCCATCCGCTACCGCCAATGGACCGGCCACGCCGACATCATCATCCCCTACCTGACCCTCGTCCCCCAGCTC
TCCCTCGGCTATCCGTGGACGCTGCTCACGACGACGCTGGTCGAGGGCAACGTCTTCACCCTCGCCATCGCCGCC
GTCACCCTCTACCACGGCGGCCGCTATCTCGAGCGCGCCTGGTCGTCGGCCGAGCTGGCAAAGTTCATCGCCCTG
GTCTCCCTGCTGCCCAACGTCCTCACCTTTGGCGTCATGACCCTCTTCTTCGCCTTGACGCGGAATGAGAGCTGG
ACCCTTGCCGTCATCTCCGGCACCGTCTCCATCCAGGTCTCCTTCCTCGTCGCCTTCAGCCAGCTCGTCCCGGCG
CACACCGTCACGCTCTTCCGCGGAATCCTTTCGCTCAGGGTCCCCCGCTTTCCGCTGCTCTACATCGGCATCGTG
ACCGTCCTGTCGCTGACGCCACTGCTGTCGCGCGCCGCTGTCTGGCTCGCCGTCTTTGGCTTTCTCACCAGCTGG
ACGTACCTGCGATTCTACAAGTCCGTCTTCCCCGATCTCGACTCGTCGCAGCCGGCGTCCCTGCGCGGCGACGCC
AGCGAGACCTTTGCCTTCGCCGAGTTCTTCCCGGGCCCGGTCAAGCCTCTGGTGTCCGCCTTCGCCGACCAGGTC
TTCGACGTCCTCGTCGCCCTGCGTCTCTGCACGCCCTTCTCGCAGGCCGACATGTCGGCCGCCCGCGGCGAGAGG
TTCTTGCAGCGAGGCACGCCGGGCAGCGCCCGCGCCGAGGCGGAGAGGCGCAGGGCAATCGCGCTCAAGGCGCTG
GACCAGAGGCTCAACGCCGCCACGGCCAACGCGGCCCTCAAGCAGGCCTCGCAACCCCCCGCTCAGCCGGTAGGC
CCGACGGTCCAGACACAGCCGCAGCCCAGCACTCAAACGGCAATGACGTCTCAGCCCGGCCCCATTCTCGGGGAG
ACCAAGTTCGAGCCGGACGACGACGAGGACCAGGCGGAGAAGAGCTGA
Transcript >Hirsu2|3396
ATGCCTCCGCGAATAAACATCCCGCCCTTCACCCGCGCCGTCCTCGTCGCCCTCGTCTTCCAGTCTGTCCTCAGC
GCCGCCATCCGCTACCGCCAATGGACCGGCCACGCCGACATCATCATCCCCTACCTGACCCTCGTCCCCCAGCTC
TCCCTCGGCTATCCGTGGACGCTGCTCACGACGACGCTGGTCGAGGGCAACGTCTTCACCCTCGCCATCGCCGCC
GTCACCCTCTACCACGGCGGCCGCTATCTCGAGCGCGCCTGGTCGTCGGCCGAGCTGGCAAAGTTCATCGCCCTG
GTCTCCCTGCTGCCCAACGTCCTCACCTTTGGCGTCATGACCCTCTTCTTCGCCTTGACGCGGAATGAGAGCTGG
ACCCTTGCCGTCATCTCCGGCACCGTCTCCATCCAGGTCTCCTTCCTCGTCGCCTTCAGCCAGCTCGTCCCGGCG
CACACCGTCACGCTCTTCCGCGGAATCCTTTCGCTCAGGGTCCCCCGCTTTCCGCTGCTCTACATCGGCATCGTG
ACCGTCCTGTCGCTGACGCCACTGCTGTCGCGCGCCGCTGTCTGGCTCGCCGTCTTTGGCTTTCTCACCAGCTGG
ACGTACCTGCGATTCTACAAGTCCGTCTTCCCCGATCTCGACTCGTCGCAGCCGGCGTCCCTGCGCGGCGACGCC
AGCGAGACCTTTGCCTTCGCCGAGTTCTTCCCGGGCCCGGTCAAGCCTCTGGTGTCCGCCTTCGCCGACCAGGTC
TTCGACGTCCTCGTCGCCCTGCGTCTCTGCACGCCCTTCTCGCAGGCCGACATGTCGGCCGCCCGCGGCGAGAGG
TTCTTGCAGCGAGGCACGCCGGGCAGCGCCCGCGCCGAGGCGGAGAGGCGCAGGGCAATCGCGCTCAAGGCGCTG
GACCAGAGGCTCAACGCCGCCACGGCCAACGCGGCCCTCAAGCAGGCCTCGCAACCCCCCGCTCAGCCGGTAGGC
CCGACGGTCCAGACACAGCCGCAGCCCAGCACTCAAACGGCAATGACGTCTCAGCCCGGCCCCATTCTCGGGGAG
ACCAAGTTCGAGCCGGACGACGACGAGGACCAGGCGGAGAAGAGCTGA
Gene >Hirsu2|3396
ATGCCTCCGCGAATAAACATCCCGCCCTTCACCCGCGCCGTCCTCGTCGCCCTCGTCTTCCAGTCTGTCCTCAGC
GCCGCCATCCGCTACCGCCAATGGACCGGCCACGCCGACATCATCATCCCCTACCTGACCCTCGTCCCCCAGCTC
TCCCTCGGCTATCCGTGGACGCTGCTCACGACGACGCTGGTCGAGGGCAACGTCTTCACCCTCGCCATCGCCGCC
GTCACCCTCTACCACGGCGGCCGCTATCTCGAGCGCGCCTGGTCGTCGGCCGAGCTGGCAAAGTTCATCGCCCTG
GTCTCCCTGCTGCCCAACGTCCTCACCTTTGGCGTCATGACCCTCTTCTTCGCCTTGACGCGGAATGAGAGCTGG
ACGTAGGTGCACCCGGGCCCCGTTGTCTGGACCCTGCTGACCGCGACCGGCTCGCCAGCCTTGCCGTCATCTCCG
GCACCGTCTCCATCCAGGTCTCCTTCCTCGTCGCCTTCAGCCAGCTCGTCCCGGCGCACACCGTCACGCTCTTCC
GCGGAATCCTTTCGCTCAGGGTCCCCCGCTTTCCGCTGCTCTACATCGGCATCGTGACCGTCCTGTCGCTGACGC
CACTGCTGTCGCGCGCCGCTGTCTGGCTCGCCGTCTTTGGCTTTCTCACCAGCTGGACGTACCTGCGATTCTACA
AGTCCGTCTTCCCCGATCTCGACTCGTCGCAGCCGGCGTCCCTGCGCGGCGACGCCAGCGAGACCTTTGCCTTCG
CCGAGTTCTTCCCGGGCCCGGTCAAGCCTCTGGTGTCCGCCTTCGCCGACCAGGTCTTCGACGTCCTCGTCGCCC
TGCGTCTCTGCACGCCCTTCTCGCAGGCCGACATGTCGGCCGCCCGCGGCGAGAGGTTCTTGCAGCGAGGCACGC
CGGGCAGCGCCCGCGCCGAGGCGGAGAGGCGCAGGGCAATCGCGCTCAAGGCGCTGGACCAGAGGCTCAACGCCG
CCACGGCCAACGCGGCCCTCAAGCAGGCCTCGCAACCCCCCGCTCAGCCGGTAGGCCCGACGGTCCAGACACAGC
CGCAGCCCAGCACTCAAACGGCAATGACGTCTCAGCCCGGCCCCATTCTCGGGGAGACCAAGTTCGAGCCGGACG
ACGACGAGGACCAGGCGGAGAAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail