Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3389
Gene name
LocationContig_1880:611..4089
Strand+
Gene length (bp)3478
Transcript length (bp)3405
Coding sequence length (bp)3405
Protein length (aa) 1135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 6.9E-93 190 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 51 1126 0.0E+00
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 30 1132 0.0E+00
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 116 1134 0.0E+00
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 16 1123 0.0E+00
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 52 1123 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 51 1126 0.0E+00
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 30 1132 0.0E+00
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 116 1134 0.0E+00
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 16 1123 0.0E+00
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 52 1123 0.0E+00
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 116 1114 0.0E+00
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 107 1123 0.0E+00
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 121 1129 0.0E+00
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 144 1105 0.0E+00
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 144 1108 5.0E-173
sp|Q752Q2|BST1_ASHGO GPI inositol-deacylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BST1 PE=3 SV=2 148 1110 5.0E-154
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BST1 PE=3 SV=1 148 1095 5.0E-153
sp|P43571|BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BST1 PE=1 SV=1 144 1106 3.0E-136
sp|Q6FLY9|BST1_CANGA GPI inositol-deacylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BST1 PE=3 SV=1 148 1104 3.0E-127
sp|Q6C2Z2|BST1A_YARLI GPI inositol-deacylase A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1A PE=3 SV=1 141 1095 2.0E-123
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 122 455 2.0E-82
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 165 457 1.0E-71
sp|P0CM51|BST1_CRYNB GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BST1 PE=3 SV=1 147 434 9.0E-55
sp|P0CM50|BST1_CRYNJ GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BST1 PE=3 SV=1 147 434 1.0E-54
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 145 444 1.0E-51
sp|Q765A7|PGAP1_RAT GPI inositol-deacylase OS=Rattus norvegicus GN=Pgap1 PE=1 SV=1 144 458 2.0E-47
sp|Q3UUQ7|PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus GN=Pgap1 PE=1 SV=3 144 458 2.0E-47
sp|Q75T13|PGAP1_HUMAN GPI inositol-deacylase OS=Homo sapiens GN=PGAP1 PE=1 SV=1 144 458 1.0E-46
sp|Q66J01|PGAP1_XENLA GPI inositol-deacylase OS=Xenopus laevis GN=pgap1 PE=2 SV=1 144 458 4.0E-42
sp|Q59VP0|BST1_CANAL GPI inositol-deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BST1 PE=3 SV=1 148 457 2.0E-40
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 669 1104 4.0E-37
sp|Q9W495|PGAP1_DROME GPI inositol-deacylase OS=Drosophila melanogaster GN=CG3160 PE=1 SV=3 128 438 5.0E-33
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 679 1114 6.0E-27
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 732 1133 9.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 112 134 22
2 873 895 22
3 897 919 22
4 950 972 22
5 999 1021 22
6 1026 1048 22
7 1068 1090 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3389
MTTSRLSTSTDDGENSTFETDPPDEISKSLPSCRGSSYQSSAAGLKARPSFSRSRQQNSFDWVRSHGSNGHILTQ
AISSTAFLSQIPSSPPLLVVTHGKMPRPFATPSFRRGSLPITLLVLISASIGIGFLVSILRSLLRHEVEAKGCRM
SYMRPSYVHFSHFDTEHTRFATKYSLYLYREQGIDDEDKLHGIPVLFIPGNAGSYKQVRPMAAEATNYFHSLFQH
DSFSRESGVRNLDFFTVDFNEDITAFHGQTLLDQAEYLNEAIRYILSLYSDPQRAERDSKRPDPTAVVVLGHSMG
GVVARAMLIQPNYQPKSINTIITMSAPHARPPVTFDGQIVHIYDEINGYWRHAYAQKWANDNPLWHVTLVSIAGG
SLDTVVPSDYASLESLVPETHGFTVFTTGIPTVWTGMDHQAILWCDQFRKVVTRALYDIIDVRRASQTKPRADRV
RLLRRRFLSGIEPTAERSVTLGEATTLLTLGDESGRIVPTGARLSIGELGRSSKPQAHLLPVPPHGSLGGMKRFS
LITDASLDDARLNASLEVLLCSVFPHQLHPYSASFSKHIDLSDGSGAATRLACLNTASDAVLLPASTSWSRYPFD
VSHGVDIRPFTYLQYDPEHLADHQFIAVIDRAASTPFGFVLAEFRDIQDVHKTYEISLAELLTLGLSFTLPADRP
FAVDVTIPAATSALFEFDLKVDQSWCQSRQNFALLIRQFLDKPYESKYFVNAKQASVSFHGTAPFLPPPLDSMMQ
RGLAFQFWSDPVCDSPVVVSLKVDAWGSFGKLYIRYRTALAAFPLLVVSMVLRNQFRVYDESGVFISFSESLDLS
LRRSIPLLLLSLTLLSSHTGALSAFGPIWSRRSGHTSSIGFQRNDLLIGTDDFLFCFLIPIIGIVCIGVCTVLHY
IMLGITQALGLLFGLAITIPPGGTKADSHSPTASPTLVPTTPRRRMISTAILLFLVSTFIPYQFAYLVACLVQLF
TVVRAFRISTIASSTINNNYYHYAHSILLLMMWVLPINLPILAVWVRNLAVHWLTPFSSHHNVLSIMPFILLVEN
LTTGRMVPRVKNRLRHVTSVLLFGTALCAAIYGMSHAYVLHYLVNSVATWLIVLHSTSNSLSLKIVGAMFDGNVN
EARKGDKTP*
Coding >Hirsu2|3389
ATGACCACCAGTCGCTTGTCTACATCCACTGATGACGGCGAGAACTCCACATTCGAGACCGACCCCCCCGATGAA
ATCAGCAAAAGTCTCCCCAGCTGCCGCGGTAGCAGCTACCAGTCGTCTGCTGCAGGTCTGAAGGCGCGTCCGTCC
TTCTCCAGGAGTAGACAGCAAAACAGCTTTGACTGGGTCCGCAGTCATGGATCGAATGGCCACATATTAACTCAA
GCTATAAGTTCCACCGCGTTCTTATCGCAGATACCCTCGTCTCCTCCGCTACTCGTCGTAACCCACGGGAAAATG
CCACGGCCGTTCGCAACTCCTAGCTTCAGGAGGGGCTCCTTGCCCATCACTCTCCTTGTTCTCATCTCCGCCAGC
ATCGGTATAGGTTTTCTCGTCTCCATCCTTAGATCTCTCTTGAGACACGAAGTCGAGGCCAAAGGTTGCCGCATG
TCCTACATGCGGCCATCGTATGTACACTTTTCCCACTTTGATACAGAACACACGCGCTTTGCGACGAAGTACTCG
CTCTATCTCTACCGCGAGCAAGGAATCGACGATGAAGATAAGTTGCATGGTATTCCAGTTCTCTTTATACCTGGA
AATGCCGGAAGCTACAAGCAGGTTCGACCGATGGCTGCCGAAGCAACCAACTATTTTCACAGTCTGTTCCAACAT
GATAGCTTTTCTCGAGAATCTGGTGTAAGAAATCTTGACTTTTTCACCGTGGACTTCAATGAGGACATCACTGCG
TTTCATGGGCAGACTTTGCTTGACCAGGCCGAATATCTCAACGAAGCAATTCGGTATATTCTTTCCCTATACTCG
GATCCGCAACGAGCCGAAAGGGACTCGAAACGACCGGATCCTACCGCTGTCGTCGTTCTCGGACACTCCATGGGA
GGTGTCGTTGCCCGCGCAATGCTGATCCAGCCAAATTATCAGCCCAAGTCTATTAACACGATCATAACCATGTCC
GCACCTCATGCGCGTCCTCCGGTCACCTTCGACGGACAAATTGTACATATTTACGACGAGATCAATGGCTACTGG
CGGCATGCGTACGCTCAAAAATGGGCCAATGATAACCCCTTATGGCACGTTACTCTTGTGTCTATAGCTGGTGGC
AGTTTGGACACTGTTGTTCCTTCAGACTACGCCAGCCTCGAATCGCTGGTGCCTGAAACGCATGGCTTTACAGTT
TTCACCACAGGGATTCCAACGGTTTGGACCGGCATGGATCACCAGGCCATCCTCTGGTGTGATCAATTCCGCAAA
GTGGTTACTCGTGCCTTGTACGATATAATCGATGTCAGGCGCGCGTCTCAAACAAAACCCAGAGCCGACAGAGTA
CGGCTTTTGAGAAGACGATTCCTTTCGGGTATTGAGCCGACCGCTGAGAGATCTGTAACGCTTGGGGAAGCTACG
ACCCTTTTGACGCTAGGCGACGAGTCTGGCCGAATTGTACCCACTGGGGCCCGACTGTCTATCGGCGAACTGGGA
CGGTCGTCCAAACCACAAGCCCATCTGCTTCCGGTTCCGCCACACGGCTCTCTTGGCGGCATGAAACGCTTTAGT
TTGATCACCGATGCAAGCCTGGACGATGCTAGGCTCAATGCAAGCTTGGAGGTCTTACTGTGCAGCGTTTTCCCA
CACCAGCTGCATCCGTACAGCGCTTCATTTTCGAAGCATATAGACTTGTCCGACGGCAGCGGTGCTGCGACCCGA
CTGGCTTGTCTGAATACAGCTTCCGACGCTGTACTTCTTCCTGCATCGACTTCTTGGAGCCGGTATCCTTTTGAC
GTCAGTCATGGAGTAGATATCCGTCCCTTTACGTACTTACAGTACGATCCTGAGCACCTTGCGGATCACCAGTTC
ATAGCTGTCATCGACCGGGCAGCGTCGACGCCATTCGGCTTCGTTCTTGCTGAGTTCAGAGATATCCAGGATGTC
CACAAGACATACGAAATCAGCCTTGCCGAACTTCTCACCCTAGGCCTGTCCTTCACTCTGCCCGCTGATCGACCT
TTTGCGGTGGATGTCACCATACCCGCTGCTACATCGGCGCTGTTTGAATTTGACTTGAAAGTCGACCAGTCATGG
TGTCAGAGCCGACAGAACTTCGCCTTGTTGATCCGGCAATTCCTAGACAAGCCGTACGAATCGAAGTACTTTGTC
AACGCCAAACAAGCAAGTGTCAGTTTTCACGGGACGGCACCTTTTCTACCTCCGCCTTTGGATTCGATGATGCAA
CGCGGGCTCGCGTTTCAATTTTGGTCCGACCCTGTGTGCGACTCGCCAGTCGTTGTTAGCTTGAAGGTCGATGCC
TGGGGCAGCTTCGGAAAGCTTTACATACGCTATCGAACTGCGCTCGCGGCCTTTCCCCTACTTGTTGTTTCCATG
GTGCTTCGGAATCAGTTTCGTGTGTACGATGAATCTGGTGTCTTCATCTCATTCTCGGAGAGCCTGGATCTGTCG
CTGCGGCGCTCCATTCCACTGCTGCTACTCTCGCTTACCCTGCTCTCTTCCCACACAGGGGCCTTGTCCGCCTTC
GGACCTATTTGGAGTCGAAGGTCGGGTCACACCTCATCGATTGGCTTTCAACGAAACGACCTACTCATCGGGACG
GATGATTTTCTCTTCTGTTTTTTGATTCCAATTATAGGCATTGTATGCATTGGCGTCTGCACAGTTCTGCATTAT
ATCATGCTGGGCATCACCCAGGCACTTGGGCTTCTTTTCGGTCTTGCGATCACCATCCCGCCTGGCGGAACAAAG
GCTGATTCGCACAGCCCGACAGCCTCGCCAACTCTTGTGCCAACCACGCCACGACGAAGAATGATATCCACAGCC
ATCCTACTCTTTTTGGTATCGACATTCATCCCTTATCAGTTCGCCTATCTGGTGGCCTGCCTCGTGCAGCTCTTC
ACCGTTGTCCGGGCCTTTCGTATCAGCACCATTGCTTCCTCGACGATAAACAACAATTACTATCATTACGCTCAC
TCCATCCTTCTCTTGATGATGTGGGTTCTCCCAATAAATCTTCCCATTCTCGCCGTGTGGGTCCGCAATCTCGCC
GTCCACTGGCTTACACCTTTCTCTTCACACCATAACGTTCTCTCCATCATGCCGTTCATTCTGCTTGTAGAGAAC
CTCACTACTGGCCGAATGGTTCCACGGGTAAAGAATCGGCTGCGTCATGTCACGAGTGTCCTGTTGTTCGGGACT
GCGCTATGTGCAGCCATCTATGGCATGTCACACGCCTACGTCCTTCACTACCTGGTTAATTCCGTGGCTACCTGG
CTCATCGTTCTGCATTCAACTTCAAATTCGTTGTCATTGAAAATTGTGGGTGCGATGTTTGATGGAAATGTAAAC
GAGGCGCGGAAAGGCGATAAGACCCCGTAA
Transcript >Hirsu2|3389
ATGACCACCAGTCGCTTGTCTACATCCACTGATGACGGCGAGAACTCCACATTCGAGACCGACCCCCCCGATGAA
ATCAGCAAAAGTCTCCCCAGCTGCCGCGGTAGCAGCTACCAGTCGTCTGCTGCAGGTCTGAAGGCGCGTCCGTCC
TTCTCCAGGAGTAGACAGCAAAACAGCTTTGACTGGGTCCGCAGTCATGGATCGAATGGCCACATATTAACTCAA
GCTATAAGTTCCACCGCGTTCTTATCGCAGATACCCTCGTCTCCTCCGCTACTCGTCGTAACCCACGGGAAAATG
CCACGGCCGTTCGCAACTCCTAGCTTCAGGAGGGGCTCCTTGCCCATCACTCTCCTTGTTCTCATCTCCGCCAGC
ATCGGTATAGGTTTTCTCGTCTCCATCCTTAGATCTCTCTTGAGACACGAAGTCGAGGCCAAAGGTTGCCGCATG
TCCTACATGCGGCCATCGTATGTACACTTTTCCCACTTTGATACAGAACACACGCGCTTTGCGACGAAGTACTCG
CTCTATCTCTACCGCGAGCAAGGAATCGACGATGAAGATAAGTTGCATGGTATTCCAGTTCTCTTTATACCTGGA
AATGCCGGAAGCTACAAGCAGGTTCGACCGATGGCTGCCGAAGCAACCAACTATTTTCACAGTCTGTTCCAACAT
GATAGCTTTTCTCGAGAATCTGGTGTAAGAAATCTTGACTTTTTCACCGTGGACTTCAATGAGGACATCACTGCG
TTTCATGGGCAGACTTTGCTTGACCAGGCCGAATATCTCAACGAAGCAATTCGGTATATTCTTTCCCTATACTCG
GATCCGCAACGAGCCGAAAGGGACTCGAAACGACCGGATCCTACCGCTGTCGTCGTTCTCGGACACTCCATGGGA
GGTGTCGTTGCCCGCGCAATGCTGATCCAGCCAAATTATCAGCCCAAGTCTATTAACACGATCATAACCATGTCC
GCACCTCATGCGCGTCCTCCGGTCACCTTCGACGGACAAATTGTACATATTTACGACGAGATCAATGGCTACTGG
CGGCATGCGTACGCTCAAAAATGGGCCAATGATAACCCCTTATGGCACGTTACTCTTGTGTCTATAGCTGGTGGC
AGTTTGGACACTGTTGTTCCTTCAGACTACGCCAGCCTCGAATCGCTGGTGCCTGAAACGCATGGCTTTACAGTT
TTCACCACAGGGATTCCAACGGTTTGGACCGGCATGGATCACCAGGCCATCCTCTGGTGTGATCAATTCCGCAAA
GTGGTTACTCGTGCCTTGTACGATATAATCGATGTCAGGCGCGCGTCTCAAACAAAACCCAGAGCCGACAGAGTA
CGGCTTTTGAGAAGACGATTCCTTTCGGGTATTGAGCCGACCGCTGAGAGATCTGTAACGCTTGGGGAAGCTACG
ACCCTTTTGACGCTAGGCGACGAGTCTGGCCGAATTGTACCCACTGGGGCCCGACTGTCTATCGGCGAACTGGGA
CGGTCGTCCAAACCACAAGCCCATCTGCTTCCGGTTCCGCCACACGGCTCTCTTGGCGGCATGAAACGCTTTAGT
TTGATCACCGATGCAAGCCTGGACGATGCTAGGCTCAATGCAAGCTTGGAGGTCTTACTGTGCAGCGTTTTCCCA
CACCAGCTGCATCCGTACAGCGCTTCATTTTCGAAGCATATAGACTTGTCCGACGGCAGCGGTGCTGCGACCCGA
CTGGCTTGTCTGAATACAGCTTCCGACGCTGTACTTCTTCCTGCATCGACTTCTTGGAGCCGGTATCCTTTTGAC
GTCAGTCATGGAGTAGATATCCGTCCCTTTACGTACTTACAGTACGATCCTGAGCACCTTGCGGATCACCAGTTC
ATAGCTGTCATCGACCGGGCAGCGTCGACGCCATTCGGCTTCGTTCTTGCTGAGTTCAGAGATATCCAGGATGTC
CACAAGACATACGAAATCAGCCTTGCCGAACTTCTCACCCTAGGCCTGTCCTTCACTCTGCCCGCTGATCGACCT
TTTGCGGTGGATGTCACCATACCCGCTGCTACATCGGCGCTGTTTGAATTTGACTTGAAAGTCGACCAGTCATGG
TGTCAGAGCCGACAGAACTTCGCCTTGTTGATCCGGCAATTCCTAGACAAGCCGTACGAATCGAAGTACTTTGTC
AACGCCAAACAAGCAAGTGTCAGTTTTCACGGGACGGCACCTTTTCTACCTCCGCCTTTGGATTCGATGATGCAA
CGCGGGCTCGCGTTTCAATTTTGGTCCGACCCTGTGTGCGACTCGCCAGTCGTTGTTAGCTTGAAGGTCGATGCC
TGGGGCAGCTTCGGAAAGCTTTACATACGCTATCGAACTGCGCTCGCGGCCTTTCCCCTACTTGTTGTTTCCATG
GTGCTTCGGAATCAGTTTCGTGTGTACGATGAATCTGGTGTCTTCATCTCATTCTCGGAGAGCCTGGATCTGTCG
CTGCGGCGCTCCATTCCACTGCTGCTACTCTCGCTTACCCTGCTCTCTTCCCACACAGGGGCCTTGTCCGCCTTC
GGACCTATTTGGAGTCGAAGGTCGGGTCACACCTCATCGATTGGCTTTCAACGAAACGACCTACTCATCGGGACG
GATGATTTTCTCTTCTGTTTTTTGATTCCAATTATAGGCATTGTATGCATTGGCGTCTGCACAGTTCTGCATTAT
ATCATGCTGGGCATCACCCAGGCACTTGGGCTTCTTTTCGGTCTTGCGATCACCATCCCGCCTGGCGGAACAAAG
GCTGATTCGCACAGCCCGACAGCCTCGCCAACTCTTGTGCCAACCACGCCACGACGAAGAATGATATCCACAGCC
ATCCTACTCTTTTTGGTATCGACATTCATCCCTTATCAGTTCGCCTATCTGGTGGCCTGCCTCGTGCAGCTCTTC
ACCGTTGTCCGGGCCTTTCGTATCAGCACCATTGCTTCCTCGACGATAAACAACAATTACTATCATTACGCTCAC
TCCATCCTTCTCTTGATGATGTGGGTTCTCCCAATAAATCTTCCCATTCTCGCCGTGTGGGTCCGCAATCTCGCC
GTCCACTGGCTTACACCTTTCTCTTCACACCATAACGTTCTCTCCATCATGCCGTTCATTCTGCTTGTAGAGAAC
CTCACTACTGGCCGAATGGTTCCACGGGTAAAGAATCGGCTGCGTCATGTCACGAGTGTCCTGTTGTTCGGGACT
GCGCTATGTGCAGCCATCTATGGCATGTCACACGCCTACGTCCTTCACTACCTGGTTAATTCCGTGGCTACCTGG
CTCATCGTTCTGCATTCAACTTCAAATTCGTTGTCATTGAAAATTGTGGGTGCGATGTTTGATGGAAATGTAAAC
GAGGCGCGGAAAGGCGATAAGACCCCGTAA
Gene >Hirsu2|3389
ATGACCACCAGTCGCTTGTCTACATCCACTGATGACGGCGAGAACTCCACATTCGAGACCGACCCCCCCGATGAA
ATCAGCAAAAGTCTCCCCAGCTGCCGCGGTAGCAGCTACCAGTCGTCTGCTGCAGGTCTGAAGGCGCGTCCGTCC
TTCTCCAGGAGTAGACAGCAAAACAGCTTTGACTGGGTCCGCAGTCATGGATCGAATGGCCACATATTAACTCAA
GCTATAAGTTCCACCGCGTTCTTATCGCAGATACCCTCGTCTCCTCCGCTACTCGTCGTAACCCACGGGAAAATG
CCACGGCCGTTCGCAACTCCTAGCTTCAGGAGGGGCTCCTTGCCCATCACTCTCCTTGTTCTCATCTCCGCCAGC
ATCGGTATAGGTTTTCTCGTCTCCATCCTTAGATCTCTCTTGAGACACGAAGTCGAGGCCAAAGGTTGCCGCATG
TCCTACATGCGGCCATCGTATGTACACTTTTCCCACTTTGATACAGAACACACGCGCTTTGCGACGAAGTACTCG
CTCTATCTCTACCGCGAGCAAGGAATCGACGATGAAGATAAGGTCTGTGCTTCCTACTGCGCATGGCAACGATTG
CGGCGACCACGCCAGGCCCACTGTTGACGCCACACGCTAGTTGCATGGTATTCCAGTTCTCTTTATACCTGGAAA
TGCCGGAAGCTACAAGCAGGTTCGACCGATGGCTGCCGAAGCAACCAACTATTTTCACAGTCTGTTCCAACATGA
TAGCTTTTCTCGAGAATCTGGTGTAAGAAATCTTGACTTTTTCACCGTGGACTTCAATGAGGACATCACTGCGTT
TCATGGGCAGACTTTGCTTGACCAGGCCGAATATCTCAACGAAGCAATTCGGTATATTCTTTCCCTATACTCGGA
TCCGCAACGAGCCGAAAGGGACTCGAAACGACCGGATCCTACCGCTGTCGTCGTTCTCGGACACTCCATGGGAGG
TGTCGTTGCCCGCGCAATGCTGATCCAGCCAAATTATCAGCCCAAGTCTATTAACACGATCATAACCATGTCCGC
ACCTCATGCGCGTCCTCCGGTCACCTTCGACGGACAAATTGTACATATTTACGACGAGATCAATGGCTACTGGCG
GCATGCGTACGCTCAAAAATGGGCCAATGATAACCCCTTATGGCACGTTACTCTTGTGTCTATAGCTGGTGGCAG
TTTGGACACTGTTGTTCCTTCAGACTACGCCAGCCTCGAATCGCTGGTGCCTGAAACGCATGGCTTTACAGTTTT
CACCACAGGGATTCCAACGGTTTGGACCGGCATGGATCACCAGGCCATCCTCTGGTGTGATCAATTCCGCAAAGT
GGTTACTCGTGCCTTGTACGATATAATCGATGTCAGGCGCGCGTCTCAAACAAAACCCAGAGCCGACAGAGTACG
GCTTTTGAGAAGACGATTCCTTTCGGGTATTGAGCCGACCGCTGAGAGATCTGTAACGCTTGGGGAAGCTACGAC
CCTTTTGACGCTAGGCGACGAGTCTGGCCGAATTGTACCCACTGGGGCCCGACTGTCTATCGGCGAACTGGGACG
GTCGTCCAAACCACAAGCCCATCTGCTTCCGGTTCCGCCACACGGCTCTCTTGGCGGCATGAAACGCTTTAGTTT
GATCACCGATGCAAGCCTGGACGATGCTAGGCTCAATGCAAGCTTGGAGGTCTTACTGTGCAGCGTTTTCCCACA
CCAGCTGCATCCGTACAGCGCTTCATTTTCGAAGCATATAGACTTGTCCGACGGCAGCGGTGCTGCGACCCGACT
GGCTTGTCTGAATACAGCTTCCGACGCTGTACTTCTTCCTGCATCGACTTCTTGGAGCCGGTATCCTTTTGACGT
CAGTCATGGAGTAGATATCCGTCCCTTTACGTACTTACAGTACGATCCTGAGCACCTTGCGGATCACCAGTTCAT
AGCTGTCATCGACCGGGCAGCGTCGACGCCATTCGGCTTCGTTCTTGCTGAGTTCAGAGATATCCAGGATGTCCA
CAAGACATACGAAATCAGCCTTGCCGAACTTCTCACCCTAGGCCTGTCCTTCACTCTGCCCGCTGATCGACCTTT
TGCGGTGGATGTCACCATACCCGCTGCTACATCGGCGCTGTTTGAATTTGACTTGAAAGTCGACCAGTCATGGTG
TCAGAGCCGACAGAACTTCGCCTTGTTGATCCGGCAATTCCTAGACAAGCCGTACGAATCGAAGTACTTTGTCAA
CGCCAAACAAGCAAGTGTCAGTTTTCACGGGACGGCACCTTTTCTACCTCCGCCTTTGGATTCGATGATGCAACG
CGGGCTCGCGTTTCAATTTTGGTCCGACCCTGTGTGCGACTCGCCAGTCGTTGTTAGCTTGAAGGTCGATGCCTG
GGGCAGCTTCGGAAAGCTTTACATACGCTATCGAACTGCGCTCGCGGCCTTTCCCCTACTTGTTGTTTCCATGGT
GCTTCGGAATCAGTTTCGTGTGTACGATGAATCTGGTGTCTTCATCTCATTCTCGGAGAGCCTGGATCTGTCGCT
GCGGCGCTCCATTCCACTGCTGCTACTCTCGCTTACCCTGCTCTCTTCCCACACAGGGGCCTTGTCCGCCTTCGG
ACCTATTTGGAGTCGAAGGTCGGGTCACACCTCATCGATTGGCTTTCAACGAAACGACCTACTCATCGGGACGGA
TGATTTTCTCTTCTGTTTTTTGATTCCAATTATAGGCATTGTATGCATTGGCGTCTGCACAGTTCTGCATTATAT
CATGCTGGGCATCACCCAGGCACTTGGGCTTCTTTTCGGTCTTGCGATCACCATCCCGCCTGGCGGAACAAAGGC
TGATTCGCACAGCCCGACAGCCTCGCCAACTCTTGTGCCAACCACGCCACGACGAAGAATGATATCCACAGCCAT
CCTACTCTTTTTGGTATCGACATTCATCCCTTATCAGTTCGCCTATCTGGTGGCCTGCCTCGTGCAGCTCTTCAC
CGTTGTCCGGGCCTTTCGTATCAGCACCATTGCTTCCTCGACGATAAACAACAATTACTATCATTACGCTCACTC
CATCCTTCTCTTGATGATGTGGGTTCTCCCAATAAATCTTCCCATTCTCGCCGTGTGGGTCCGCAATCTCGCCGT
CCACTGGCTTACACCTTTCTCTTCACACCATAACGTTCTCTCCATCATGCCGTTCATTCTGCTTGTAGAGAACCT
CACTACTGGCCGAATGGTTCCACGGGTAAAGAATCGGCTGCGTCATGTCACGAGTGTCCTGTTGTTCGGGACTGC
GCTATGTGCAGCCATCTATGGCATGTCACACGCCTACGTCCTTCACTACCTGGTTAATTCCGTGGCTACCTGGCT
CATCGTTCTGCATTCAACTTCAAATTCGTTGTCATTGAAAATTGTGGGTGCGATGTTTGATGGAAATGTAAACGA
GGCGCGGAAAGGCGATAAGACCCCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail