Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3387
Gene name
LocationContig_188:26546..28236
Strand-
Gene length (bp)1690
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.2E-33 59 242
PF00083 Sugar_tr Sugar (and other) transporter 3.6E-09 274 407
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-33 66 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 45 464 2.0E-97
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 41 422 1.0E-29
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 41 422 2.0E-29
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 41 422 2.0E-29
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 41 422 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 45 464 2.0E-97
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 41 422 1.0E-29
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 41 422 2.0E-29
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 41 422 2.0E-29
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 41 422 4.0E-29
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 41 422 5.0E-29
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 41 422 5.0E-29
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 41 422 5.0E-29
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 41 422 5.0E-29
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 41 422 5.0E-29
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 41 422 1.0E-28
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 41 422 2.0E-28
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 41 422 2.0E-28
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 41 422 2.0E-28
sp|B7LRJ2|NANT_ESCF3 Putative sialic acid transporter OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nanT PE=3 SV=1 41 422 7.0E-28
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 41 422 8.0E-28
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 41 422 1.0E-27
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 41 422 2.0E-27
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 41 422 2.0E-27
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 40 423 2.0E-26
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 41 422 2.0E-26
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 41 422 2.0E-26
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 40 423 4.0E-26
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 40 423 4.0E-26
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 40 423 5.0E-26
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 40 423 5.0E-26
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 40 423 5.0E-26
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 40 423 5.0E-26
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 40 423 6.0E-26
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 56 407 5.0E-24
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 52 424 8.0E-21
sp|P94131|MUCK_ACIAD Cis,cis-muconate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mucK PE=3 SV=1 71 416 1.0E-19
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 52 421 8.0E-19
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 102 453 2.0E-12
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 102 475 2.0E-12
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 102 475 2.0E-12
sp|Q47421|OUSA_DICD3 Osmoprotectant uptake system A OS=Dickeya dadantii (strain 3937) GN=ousA PE=3 SV=2 102 424 5.0E-12
sp|P71369|Y1104_HAEIN Putative metabolite transport protein HI_1104 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1104 PE=3 SV=1 52 406 2.0E-10
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 110 242 2.0E-08
sp|Q6GBR4|PROP_STAAS Putative proline/betaine transporter OS=Staphylococcus aureus (strain MSSA476) GN=proP PE=3 SV=1 67 216 5.0E-08
sp|Q8NXW9|PROP_STAAW Putative proline/betaine transporter OS=Staphylococcus aureus (strain MW2) GN=proP PE=3 SV=1 67 216 5.0E-08
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 57 408 5.0E-08
sp|Q5HIA2|PROP_STAAC Putative proline/betaine transporter OS=Staphylococcus aureus (strain COL) GN=proP PE=3 SV=1 67 216 5.0E-08
sp|Q99W36|PROP_STAAM Putative proline/betaine transporter OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=proP PE=3 SV=1 67 216 5.0E-08
sp|Q7A771|PROP_STAAN Putative proline/betaine transporter OS=Staphylococcus aureus (strain N315) GN=proP PE=3 SV=1 67 216 5.0E-08
sp|Q9KWK6|PROP_STAA1 Putative proline/betaine transporter OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=proP PE=3 SV=3 67 216 5.0E-08
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 99 242 6.0E-08
sp|Q6GJ96|PROP_STAAR Putative proline/betaine transporter OS=Staphylococcus aureus (strain MRSA252) GN=proP PE=3 SV=1 67 216 9.0E-08
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 34 239 1.0E-07
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 86 239 1.0E-07
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 86 239 1.0E-07
sp|P77589|MHPT_ECOLI 3-(3-hydroxy-phenyl)propionate transporter OS=Escherichia coli (strain K12) GN=mhpT PE=1 SV=2 70 410 2.0E-07
sp|P77228|YDFJ_ECOLI Putative inner membrane metabolite transport protein YdfJ OS=Escherichia coli (strain K12) GN=ydfJ PE=5 SV=1 108 367 3.0E-07
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 102 379 4.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 54 250 6.0E-07
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 99 246 2.0E-06
sp|O30513|BENK_ACIAD Benzoate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benK PE=3 SV=2 111 246 2.0E-06
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 47 242 2.0E-06
sp|Q8NLB7|GENK_CORGL Gentisate transporter OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=genK PE=1 SV=2 64 413 2.0E-06
sp|P76350|SHIA_ECOLI Shikimate transporter OS=Escherichia coli (strain K12) GN=shiA PE=3 SV=1 106 356 3.0E-06
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 47 252 3.0E-06
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 51 379 5.0E-06
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 41 257 5.0E-06
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 103 256 5.0E-06
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 68 239 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 97 119 22
3 126 148 22
4 152 174 22
5 186 208 22
6 218 237 19
7 271 293 22
8 313 332 19
9 353 375 22
10 439 461 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3387
MSDHDGQQRGWSTPDTASDSKTGTTVCRYLASRLPTLKPPMDRMVNPIKAMRSLNKEQWTFFAVAWCGWVMDSFD
FFTVSLTLTNLADTFHKKESDITWGISLVLMLRPVGAIFFGAWGDRYGRKWPFIVNNIMFIAFELGTGFCHTYGQ
FLAIRSMFGIAMGGLYGNAVATALEDCPDAARGIMSGLFQGGYPFGYLLATAMARALVDTTSHGWRPLFWFSAGP
PVFLIVWRYFLPETQTFRERQMLRKSTSEASTPGFFAQAGAAIRRYWLVLIYMIVFMAGFSYMSHGSQDMYPTLL
VNQYNFSDDMKTVTQVVANIGAVIGAVVVGNLSEMFGRRLTIIAACAMAGALLYPYTFVSTPAIMAAAFFVQFAI
QGAFGVVPSHLMELSPPDLRAFVVGTAYQLGSLASSPAATIQSEIAEDNFPLSPGPNGRPRYNYAEVICAVLGAA
LGVVIIVTFLGPENKGARFSMAGIQAVAKPGSSPASSGPLDKEKEEEEGGGA*
Coding >Hirsu2|3387
ATGTCTGATCACGATGGCCAGCAACGGGGCTGGTCGACACCGGACACGGCCAGCGACTCCAAGACCGGCACGACC
GTCTGTCGCTACCTGGCCTCGCGGCTGCCGACCCTGAAGCCGCCCATGGACAGGATGGTCAACCCGATCAAGGCC
ATGAGGTCGCTGAACAAAGAACAATGGACCTTCTTCGCCGTTGCCTGGTGCGGCTGGGTCATGGACTCGTTCGAC
TTCTTCACCGTCAGCCTGACCCTCACCAACCTGGCCGACACGTTCCACAAGAAGGAGTCGGACATCACCTGGGGC
ATATCGCTGGTGCTCATGCTGCGGCCCGTCGGTGCCATCTTCTTCGGCGCGTGGGGCGATCGGTACGGCAGGAAA
TGGCCGTTCATCGTCAACAACATCATGTTCATCGCCTTCGAGCTGGGCACCGGCTTCTGCCACACCTACGGCCAG
TTCCTGGCCATCAGATCCATGTTCGGCATTGCCATGGGCGGCCTGTACGGCAACGCGGTCGCGACGGCGCTCGAA
GACTGCCCGGACGCCGCCCGCGGCATCATGTCGGGTCTGTTCCAGGGCGGCTACCCCTTCGGCTACCTCCTCGCG
ACCGCCATGGCCAGGGCGCTGGTCGACACGACCAGCCACGGCTGGCGGCCACTGTTCTGGTTCAGCGCCGGGCCG
CCCGTCTTCCTCATCGTCTGGAGGTACTTCCTGCCGGAGACGCAGACGTTCCGTGAGCGCCAGATGCTGCGCAAG
TCGACGTCGGAGGCCTCGACGCCCGGCTTTTTCGCGCAGGCCGGCGCGGCCATCAGGAGGTACTGGCTCGTGCTC
ATCTACATGATCGTCTTCATGGCCGGCTTCTCGTACATGTCGCACGGATCGCAGGACATGTACCCGACGCTGCTG
GTGAACCAGTACAACTTCAGCGACGACATGAAGACGGTGACGCAGGTGGTGGCCAACATCGGGGCCGTCATCGGG
GCCGTCGTCGTGGGCAACCTGTCGGAGATGTTCGGGCGGCGGCTGACCATCATCGCGGCGTGCGCCATGGCGGGC
GCGCTGCTGTACCCCTACACGTTCGTCTCGACGCCGGCCATCATGGCGGCCGCCTTCTTCGTCCAGTTCGCGATC
CAGGGCGCCTTCGGCGTCGTGCCCAGCCACCTGATGGAGCTGTCGCCGCCGGACCTGCGCGCCTTCGTCGTCGGC
ACCGCCTACCAGCTCGGCAGCCTGGCGTCGAGCCCCGCGGCCACGATCCAGTCGGAGATCGCCGAGGACAACTTC
CCGCTCTCGCCCGGCCCGAACGGCCGCCCGCGCTACAACTACGCCGAGGTCATCTGCGCCGTCCTCGGCGCCGCC
CTCGGCGTCGTCATCATCGTCACCTTCCTCGGCCCGGAGAACAAGGGCGCCCGCTTCAGCATGGCCGGCATCCAG
GCCGTCGCCAAGCCCGGCTCGTCGCCCGCCAGCTCCGGCCCACTCGACAAGGAGAAGGAGGAGGAGGAGGGGGGG
GGCGCATGA
Transcript >Hirsu2|3387
ATGTCTGATCACGATGGCCAGCAACGGGGCTGGTCGACACCGGACACGGCCAGCGACTCCAAGACCGGCACGACC
GTCTGTCGCTACCTGGCCTCGCGGCTGCCGACCCTGAAGCCGCCCATGGACAGGATGGTCAACCCGATCAAGGCC
ATGAGGTCGCTGAACAAAGAACAATGGACCTTCTTCGCCGTTGCCTGGTGCGGCTGGGTCATGGACTCGTTCGAC
TTCTTCACCGTCAGCCTGACCCTCACCAACCTGGCCGACACGTTCCACAAGAAGGAGTCGGACATCACCTGGGGC
ATATCGCTGGTGCTCATGCTGCGGCCCGTCGGTGCCATCTTCTTCGGCGCGTGGGGCGATCGGTACGGCAGGAAA
TGGCCGTTCATCGTCAACAACATCATGTTCATCGCCTTCGAGCTGGGCACCGGCTTCTGCCACACCTACGGCCAG
TTCCTGGCCATCAGATCCATGTTCGGCATTGCCATGGGCGGCCTGTACGGCAACGCGGTCGCGACGGCGCTCGAA
GACTGCCCGGACGCCGCCCGCGGCATCATGTCGGGTCTGTTCCAGGGCGGCTACCCCTTCGGCTACCTCCTCGCG
ACCGCCATGGCCAGGGCGCTGGTCGACACGACCAGCCACGGCTGGCGGCCACTGTTCTGGTTCAGCGCCGGGCCG
CCCGTCTTCCTCATCGTCTGGAGGTACTTCCTGCCGGAGACGCAGACGTTCCGTGAGCGCCAGATGCTGCGCAAG
TCGACGTCGGAGGCCTCGACGCCCGGCTTTTTCGCGCAGGCCGGCGCGGCCATCAGGAGGTACTGGCTCGTGCTC
ATCTACATGATCGTCTTCATGGCCGGCTTCTCGTACATGTCGCACGGATCGCAGGACATGTACCCGACGCTGCTG
GTGAACCAGTACAACTTCAGCGACGACATGAAGACGGTGACGCAGGTGGTGGCCAACATCGGGGCCGTCATCGGG
GCCGTCGTCGTGGGCAACCTGTCGGAGATGTTCGGGCGGCGGCTGACCATCATCGCGGCGTGCGCCATGGCGGGC
GCGCTGCTGTACCCCTACACGTTCGTCTCGACGCCGGCCATCATGGCGGCCGCCTTCTTCGTCCAGTTCGCGATC
CAGGGCGCCTTCGGCGTCGTGCCCAGCCACCTGATGGAGCTGTCGCCGCCGGACCTGCGCGCCTTCGTCGTCGGC
ACCGCCTACCAGCTCGGCAGCCTGGCGTCGAGCCCCGCGGCCACGATCCAGTCGGAGATCGCCGAGGACAACTTC
CCGCTCTCGCCCGGCCCGAACGGCCGCCCGCGCTACAACTACGCCGAGGTCATCTGCGCCGTCCTCGGCGCCGCC
CTCGGCGTCGTCATCATCGTCACCTTCCTCGGCCCGGAGAACAAGGGCGCCCGCTTCAGCATGGCCGGCATCCAG
GCCGTCGCCAAGCCCGGCTCGTCGCCCGCCAGCTCCGGCCCACTCGACAAGGAGAAGGAGGAGGAGGAGGGGGGG
GGCGCATGA
Gene >Hirsu2|3387
ATGTCTGATCACGATGGCCAGCAACGGGGCTGGTCGACACCGGACACGGCCAGCGACTCCAAGACCGGCACGACC
GTCTGTCGCTACCTGGCCTCGCGGCTGCCGACCCTGAAGCCGCCCATGGACAGGATGGTCAACCCGATCAAGGCC
ATGAGGTCGCTGAACAAAGAACAATGGACCTTCTTCGCCGTCAGTATCCTTGCCTAGATGCCGGCTACCAAGCCT
CCTGCCCCCCTTCCCCCGGATGCCTCGACCGCCTTACACGCGGCTGACAGCAAAAAAAAAACACATGTGCAGGTT
GCCTGGTGCGGCTGGGTCATGGACTCGTTCGACTTCTTCACCGTCAGCCTGACCCTCACCAACCTGGCCGACACG
TTCCACAAGAAGGAGTCGGACATCACCTGGGGCATATCGCTGGTGCTCATGCTGCGGCCCGTCGGTGCCATCTTC
TTCGGCGCGTGGGGCGATCGGTACGGCAGGAAATGGCCGTTCATCGTCAACAACATCATGTTCATCGCCTTCGAG
CTGGGCACCGGCTTCTGCCACACCTACGGCCAGTTCCTGGCCATCAGATCCATGTTCGGCATTGCCATGGGCGGC
CTGTACGGCAACGCGGTCGCGACGGCGCTCGAAGACTGCCCGGACGCCGCCCGCGGCATCATGTCGGGTCTGTTC
CAGGGCGGCTACCCCTTCGGCTACCTCCTCGCGACCGCCATGGCCAGGGCGCTGGTCGACACGACCAGCCACGGC
TGGCGGCCACTGTTCTGGTTCAGCGCCGGGCCGCCCGTCTTCCTCATCGTCTGGAGGTACTTCCTGCCGGAGACG
CAGACGTTCCGTGAGCGCCAGATGCTGCGCAAGTCGACGTCGGAGGCCTCGACGCCCGGCTTTTTCGCGCAGGCC
GGCGCGGCCATCAGGAGGTACTGGCTCGTGCTCATCTACATGATCGTCTTCATGGCCGGCTTCTCGTACATGGTA
GGTGGCCGCCCCCCCGAGTGTCCGTCTCCCGGCGCGAGCAAGAGCTGACACGGCCCGTCCGCCATGGCAGTCGCA
CGGATCGCAGGACATGTACCCGACGCTGCTGGTGAACCAGTACAACTTCAGCGACGACATGAAGACGGTGACGCA
GGTGGTGGCCAACATCGGGGCCGTCATCGGGGCCGTCGTCGTGGGCAACCTGTCGGAGATGTTCGGGCGGCGGCT
GACCATCATCGCGGCGTGCGCCATGGCGGGCGCGCTGCTGTACCCCTACACGTTCGTCTCGACGCCGGCCATCAT
GGCGGCCGCCTTCTTCGTCCAGTTCGCGATCCAGGGCGCCTTCGGCGTCGTGCCCAGCCACCTGATGGAGCTGTC
GCCGCCGGACCTGCGCGCCTTCGTCGTCGGCACCGCCTACCAGCTCGGCAGCCTGGCGTCGAGCCCCGCGGCCAC
GATCCAGTCGGAGATCGCCGAGGACAACTTCCCGCTCTCGCCCGGCCCGAACGGCCGCCCGCGCTACAACTACGC
CGAGGTCATCTGCGCCGTCCTCGGCGCCGCCCTCGGCGTCGTCATCATCGTCACCTTCCTCGGCCCGGAGAACAA
GGGCGCCCGCTTCAGCATGGCCGGCATCCAGGCCGTCGCCAAGCCCGGCTCGTCGCCCGCCAGCTCCGGCCCACT
CGACAAGGAGAAGGAGGAGGAGGAGGGGGGGGGCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail