Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3386
Gene name
LocationContig_188:23739..26087
Strand+
Gene length (bp)2348
Transcript length (bp)2058
Coding sequence length (bp)2058
Protein length (aa) 686

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.2E-06 323 383
PF01480 PWI PWI domain 2.5E-07 11 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP9|YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC902.04 PE=1 SV=1 296 659 3.0E-37
sp|Q9USP9|YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC902.04 PE=1 SV=1 2 95 5.0E-14
sp|Q5T8P6|RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens GN=RBM26 PE=1 SV=3 6 91 2.0E-11
sp|Q6NZN0|RBM26_MOUSE RNA-binding protein 26 OS=Mus musculus GN=Rbm26 PE=1 SV=2 11 91 3.0E-11
sp|Q2T9I5|RBM26_XENLA RNA-binding protein 26 OS=Xenopus laevis GN=rbm26 PE=2 SV=2 6 81 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP9|YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC902.04 PE=1 SV=1 296 659 3.0E-37
sp|Q9USP9|YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC902.04 PE=1 SV=1 2 95 5.0E-14
sp|Q5T8P6|RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens GN=RBM26 PE=1 SV=3 6 91 2.0E-11
sp|Q6NZN0|RBM26_MOUSE RNA-binding protein 26 OS=Mus musculus GN=Rbm26 PE=1 SV=2 11 91 3.0E-11
sp|Q2T9I5|RBM26_XENLA RNA-binding protein 26 OS=Xenopus laevis GN=rbm26 PE=2 SV=2 6 81 5.0E-10
sp|Q9P2N5|RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens GN=RBM27 PE=1 SV=2 6 88 1.0E-09
sp|Q5SFM8|RBM27_MOUSE RNA-binding protein 27 OS=Mus musculus GN=Rbm27 PE=1 SV=3 6 88 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0003676 nucleic acid binding Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006396 RNA processing No
GO:0016071 mRNA metabolic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3386
MLFPEEDGPLLKAWIVKRIENTSDADSDVLAEYVIALLKHDGTQDSIRKLCEQEIPDFLTEEPKAFLDDVFRAIQ
HRSYVPGAPPPPPASGEPSTRPGGPQPAHADATGAQLGSKKRPFADRGDAAEAGEHDQADQRSYKQPRRGGRRGM
DDGRGARAPGFRSATMPSLPLGMPHFDPNNPMEAIMQMQAMGIPFAGLPNLPQPALGPRPPRNQAKWKGRCRDFD
TKGYCSRGSTCMYDHGNESIYVPPAPARGEEYDPNDAVMYVPTAHGQANSTLFNSPESARGRGGRRGRGNGGRGS
RRGGARAPFSADGPVNDRSKSTIVVENIPEENFSDDQVREFFSQFGNVVSVSMQPYKHLAIVKFDKWAAANDAYR
SPTVIFNNRFVKVFWYKEVTEGLPPMAPLNGSGDAISVRESEPEVDMEEFQRKQEEAQRQHQERQSKREELARRK
QELEKQQQDLLAKHQAETEQLRARLVEKNGGDGPGPGSSSGTDVLRAQLAALEQEAKILGLDPNASDDGGPPGFR
GGFRGRRGFRGRPRGRASFRGQGARHAAYAQYSIDNRPKKLAIHGADFTPPERDEMLRHFLLNLGEFESVETAPS
VTHVSFQDRKTAERFYASLHGKELPGVDGKLELSWAGAPPLAPTSGLSDDGAGGDDDDDAKDEAPRPVDMDYEVG
DDDAWDEGIR*
Coding >Hirsu2|3386
ATGCTGTTCCCCGAGGAGGACGGGCCGCTGCTGAAGGCTTGGATCGTCAAGCGGATTGAGAATACGTCCGATGCC
GACTCAGACGTGCTGGCCGAGTACGTGATCGCGCTGCTCAAGCACGACGGCACCCAGGACTCGATCCGCAAGCTC
TGCGAGCAGGAGATCCCCGACTTCCTGACCGAAGAGCCCAAGGCCTTTCTGGACGATGTGTTCCGGGCCATCCAG
CACCGATCCTACGTGCCCGGAGCGCCGCCGCCGCCGCCGGCGTCCGGCGAGCCGTCGACTCGTCCCGGCGGCCCG
CAGCCTGCCCATGCCGACGCGACGGGCGCTCAGCTCGGCTCGAAAAAGAGGCCCTTCGCCGACAGGGGCGATGCT
GCCGAGGCCGGAGAGCACGACCAGGCCGACCAGCGGTCCTACAAGCAGCCCAGACGAGGCGGGCGACGGGGGATG
GACGACGGTCGCGGCGCCAGGGCGCCGGGCTTTCGCTCCGCCACCATGCCGTCTCTGCCCCTGGGCATGCCGCAC
TTCGACCCCAACAATCCGATGGAGGCCATCATGCAGATGCAGGCCATGGGCATCCCCTTCGCCGGCCTGCCCAAC
CTCCCTCAGCCGGCCTTGGGCCCGAGGCCGCCCAGAAATCAGGCTAAGTGGAAAGGCCGCTGTCGCGACTTCGAC
ACCAAGGGCTACTGCTCCCGAGGGAGCACTTGCATGTACGACCACGGCAACGAGTCCATCTACGTCCCTCCCGCG
CCCGCGCGGGGCGAGGAATACGATCCCAACGACGCCGTCATGTACGTGCCGACGGCGCATGGCCAGGCCAACTCG
ACCCTCTTCAACAGCCCCGAATCGGCCCGCGGCCGCGGCGGTAGGAGAGGGCGAGGCAACGGCGGTCGCGGCAGC
CGGAGAGGCGGCGCGCGCGCACCGTTTTCCGCCGACGGGCCGGTCAACGATCGCTCCAAGAGCACGATTGTGGTC
GAGAACATACCCGAGGAAAACTTCTCCGACGACCAGGTGCGCGAATTTTTCTCGCAGTTTGGAAACGTCGTCAGC
GTCTCGATGCAGCCGTACAAGCATCTGGCCATCGTCAAATTCGACAAGTGGGCCGCGGCCAACGACGCCTACCGG
TCTCCCACCGTCATCTTCAACAACCGGTTCGTTAAGGTCTTTTGGTACAAGGAGGTGACGGAGGGCCTGCCTCCG
ATGGCGCCCCTCAACGGGAGCGGTGACGCGATCTCCGTCCGGGAGTCGGAGCCGGAAGTCGACATGGAAGAGTTC
CAAAGGAAGCAGGAAGAGGCGCAGCGGCAGCATCAGGAGAGGCAGTCGAAGCGGGAGGAGCTGGCGCGACGGAAG
CAGGAGCTGGAGAAGCAGCAGCAAGACCTGCTGGCAAAGCATCAGGCCGAGACGGAGCAGCTGCGGGCGAGGCTG
GTGGAGAAGAACGGCGGCGACGGCCCCGGCCCCGGCTCCTCGTCGGGCACGGACGTGCTGCGGGCCCAGCTGGCC
GCCCTCGAGCAGGAGGCCAAGATACTGGGCCTCGACCCCAACGCGAGCGACGACGGCGGCCCGCCGGGCTTCCGC
GGGGGGTTCAGGGGCCGGAGGGGCTTCCGCGGCCGGCCGCGCGGCCGCGCCTCGTTCCGGGGCCAGGGAGCCCGG
CACGCCGCCTACGCCCAGTACTCGATCGACAACCGGCCCAAGAAGCTGGCCATCCACGGCGCCGACTTCACGCCG
CCCGAGCGGGACGAGATGCTGCGCCATTTCCTTCTGAACCTCGGCGAGTTCGAGTCGGTCGAGACGGCGCCGTCG
GTGACGCACGTGTCCTTCCAGGACCGCAAGACGGCCGAGCGCTTCTACGCCAGCCTGCACGGCAAGGAGCTCCCC
GGCGTCGACGGCAAGCTGGAGCTGTCGTGGGCGGGCGCGCCGCCGCTGGCGCCCACGTCGGGCCTGTCCGACGAC
GGCGCGGGCGGCGACGACGACGACGACGCCAAGGACGAGGCGCCGCGCCCGGTCGACATGGACTACGAGGTCGGC
GACGACGACGCCTGGGACGAGGGCATCCGGTAG
Transcript >Hirsu2|3386
ATGCTGTTCCCCGAGGAGGACGGGCCGCTGCTGAAGGCTTGGATCGTCAAGCGGATTGAGAATACGTCCGATGCC
GACTCAGACGTGCTGGCCGAGTACGTGATCGCGCTGCTCAAGCACGACGGCACCCAGGACTCGATCCGCAAGCTC
TGCGAGCAGGAGATCCCCGACTTCCTGACCGAAGAGCCCAAGGCCTTTCTGGACGATGTGTTCCGGGCCATCCAG
CACCGATCCTACGTGCCCGGAGCGCCGCCGCCGCCGCCGGCGTCCGGCGAGCCGTCGACTCGTCCCGGCGGCCCG
CAGCCTGCCCATGCCGACGCGACGGGCGCTCAGCTCGGCTCGAAAAAGAGGCCCTTCGCCGACAGGGGCGATGCT
GCCGAGGCCGGAGAGCACGACCAGGCCGACCAGCGGTCCTACAAGCAGCCCAGACGAGGCGGGCGACGGGGGATG
GACGACGGTCGCGGCGCCAGGGCGCCGGGCTTTCGCTCCGCCACCATGCCGTCTCTGCCCCTGGGCATGCCGCAC
TTCGACCCCAACAATCCGATGGAGGCCATCATGCAGATGCAGGCCATGGGCATCCCCTTCGCCGGCCTGCCCAAC
CTCCCTCAGCCGGCCTTGGGCCCGAGGCCGCCCAGAAATCAGGCTAAGTGGAAAGGCCGCTGTCGCGACTTCGAC
ACCAAGGGCTACTGCTCCCGAGGGAGCACTTGCATGTACGACCACGGCAACGAGTCCATCTACGTCCCTCCCGCG
CCCGCGCGGGGCGAGGAATACGATCCCAACGACGCCGTCATGTACGTGCCGACGGCGCATGGCCAGGCCAACTCG
ACCCTCTTCAACAGCCCCGAATCGGCCCGCGGCCGCGGCGGTAGGAGAGGGCGAGGCAACGGCGGTCGCGGCAGC
CGGAGAGGCGGCGCGCGCGCACCGTTTTCCGCCGACGGGCCGGTCAACGATCGCTCCAAGAGCACGATTGTGGTC
GAGAACATACCCGAGGAAAACTTCTCCGACGACCAGGTGCGCGAATTTTTCTCGCAGTTTGGAAACGTCGTCAGC
GTCTCGATGCAGCCGTACAAGCATCTGGCCATCGTCAAATTCGACAAGTGGGCCGCGGCCAACGACGCCTACCGG
TCTCCCACCGTCATCTTCAACAACCGGTTCGTTAAGGTCTTTTGGTACAAGGAGGTGACGGAGGGCCTGCCTCCG
ATGGCGCCCCTCAACGGGAGCGGTGACGCGATCTCCGTCCGGGAGTCGGAGCCGGAAGTCGACATGGAAGAGTTC
CAAAGGAAGCAGGAAGAGGCGCAGCGGCAGCATCAGGAGAGGCAGTCGAAGCGGGAGGAGCTGGCGCGACGGAAG
CAGGAGCTGGAGAAGCAGCAGCAAGACCTGCTGGCAAAGCATCAGGCCGAGACGGAGCAGCTGCGGGCGAGGCTG
GTGGAGAAGAACGGCGGCGACGGCCCCGGCCCCGGCTCCTCGTCGGGCACGGACGTGCTGCGGGCCCAGCTGGCC
GCCCTCGAGCAGGAGGCCAAGATACTGGGCCTCGACCCCAACGCGAGCGACGACGGCGGCCCGCCGGGCTTCCGC
GGGGGGTTCAGGGGCCGGAGGGGCTTCCGCGGCCGGCCGCGCGGCCGCGCCTCGTTCCGGGGCCAGGGAGCCCGG
CACGCCGCCTACGCCCAGTACTCGATCGACAACCGGCCCAAGAAGCTGGCCATCCACGGCGCCGACTTCACGCCG
CCCGAGCGGGACGAGATGCTGCGCCATTTCCTTCTGAACCTCGGCGAGTTCGAGTCGGTCGAGACGGCGCCGTCG
GTGACGCACGTGTCCTTCCAGGACCGCAAGACGGCCGAGCGCTTCTACGCCAGCCTGCACGGCAAGGAGCTCCCC
GGCGTCGACGGCAAGCTGGAGCTGTCGTGGGCGGGCGCGCCGCCGCTGGCGCCCACGTCGGGCCTGTCCGACGAC
GGCGCGGGCGGCGACGACGACGACGACGCCAAGGACGAGGCGCCGCGCCCGGTCGACATGGACTACGAGGTCGGC
GACGACGACGCCTGGGACGAGGGCATCCGGTAG
Gene >Hirsu2|3386
ATGCTGTTCCCCGAGGAGGACGGGCCGCTGCTGAAGGCTTGGATCGTCAAGCGGATTGAGAATACGTGAGTGGCT
GGCCCTTTGTCGCTCCCTCTGTCGGGCGACGGCTCTCGCGCCGCGCCTTGCTGACGCGGCTGCAGGTCCGATGCC
GACTCAGACGTGCTGGCCGAGTACGTGATCGCGCTGCTCAAGCACGACGGCACCCAGGACTCGATCCGCAAGCTC
TGCGAGCAGGAGATCCCCGACTTCCTGACCGAAGGTGCGCCGCCCTGCCCCGACACGTCGCTCGCGTCGCCCGCG
TCGCCCCCGTGCTGACCCCCCCCGGCTCCCCCGTGCAGAGCCCAAGGCCTTTCTGGACGATGTGTTCCGGGCCAT
CCAGCACCGATCCTACGTGCCCGGAGCGCCGCCGCCGCCGCCGGCGTCCGGCGAGCCGTCGACTCGTCCCGGCGG
CCCGCAGCCTGCCCATGCCGACGCGACGGGCGCTCAGCTCGGCTCGAAAAAGAGGCCCTTCGCCGACAGGGGCGA
TGCTGCCGAGGCCGGAGAGCACGACCAGGCCGACCAGCGGTCCTACAAGCAGCCCAGACGAGGCGGGCGACGGGG
GATGGACGACGGTCGCGGCGCCAGGGCGCCGGGCTTTCGCTCCGCCACCATGCCGTCTCTGCCCCTGGGCATGCC
GCACTTCGACCCCAACAATCCGATGGAGGCCATCATGCAGATGCAGGCCATGGGCATCCCCTTCGCCGGCCTGCC
CAACCTCCCTCAGCCGGCCTTGGGCCCGAGGCCGCCCAGAAATCAGGCTAAGTGGAAAGGCCGCTGTCGCGACTT
CGACACCAAGGGCTACTGCTCCCGAGGGAGCACTTGCATGTACGACCACGGCAACGAGTCCATCTACGTCCCTCC
CGCGCCCGCGCGGGGCGAGGGTAAGTCTACGAAGCACCTGCTACTGGTGTTGCTGCTGCTGCTGCTGCTCCTCGT
CCTCGAGCTGGACTGACATTGGCCGCAGAATACGATCCCAACGACGCCGTCATGTACGTGCCGACGGCGCATGGC
CAGGCCAACTCGACCCTCTTCAACAGCCCCGAATCGGCCCGCGGCCGCGGCGGTAGGAGAGGGCGAGGCAACGGC
GGTCGCGGCAGCCGGAGAGGCGGCGCGCGCGCACCGTTTTCCGCCGACGGGCCGGTCAACGATCGCTCCAAGAGC
ACGATTGTGGTCGAGAACATACCCGAGGAAAACTTCTCCGACGACCAGGTGCGCGAATTTTTCTCGCAGTTTGGA
AACGTCGTCAGCGTCTCGATGCAGCCGTACAAGCATCTGGCCATCGTCAAATTCGACAAGTGGGCCGCGGCCAAC
GACGCCTACCGGTCTCCCACCGTCATCTTCAACAACCGGTTCGTTAAGGTCTTTTGGTACAAGGAGGTGACGGAG
GGCCTGCCTCCGATGGCGCCCCTCAACGGGAGCGGTGACGCGATCTCCGTCCGGGAGTCGGAGCCGGAAGTCGAC
ATGGAAGAGTTCCAAAGGAAGCAGGAAGAGGCGCAGCGGCAGCATCAGGAGAGGCAGTCGAAGCGGGAGGAGCTG
GCGCGACGGAAGCAGGAGCTGGAGAAGCAGCAGCAAGACCTGCTGGCAAAGCATCAGGCCGAGACGGAGCAGCTG
CGGGCGAGGCTGGTGGAGAAGAACGGCGGCGACGGCCCCGGCCCCGGCTCCTCGTCGGGCACGGACGTGCTGCGG
GCCCAGCTGGCCGCCCTCGAGCAGGAGGCCAAGATACTGGGCCTCGACCCCAACGCGAGCGACGACGGCGGCCCG
CCGGGCTTCCGCGGGGGGTTCAGGGGCCGGAGGGGCTTCCGCGGCCGGCCGCGCGGCCGCGCCTCGTTCCGGGGC
CAGGGAGCCCGGCACGCCGCCTACGCCCAGTACTCGATCGACAACCGGCCCAAGAAGCTGGCCATCCACGGCGCC
GACTTCACGCCGCCCGAGCGGGACGAGATGCTGCGCCATTTCCTTCTGGTGAGTTTTTTTGCGACGACGTTCCCT
CGTGACGGCCGCTGACGACGGGGTAGAACCTCGGCGAGTTCGAGTCGGTCGAGACGGCGCCGTCGGTGACGCACG
TGTCCTTCCAGGACCGCAAGACGGCCGAGCGCTTCTACGCCAGCCTGCACGGCAAGGAGCTCCCCGGCGTCGACG
GCAAGCTGGAGCTGTCGTGGGCGGGCGCGCCGCCGCTGGCGCCCACGTCGGGCCTGTCCGACGACGGCGCGGGCG
GCGACGACGACGACGACGCCAAGGACGAGGCGCCGCGCCCGGTCGACATGGACTACGAGGTCGGCGACGACGACG
CCTGGGACGAGGGCATCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail