Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3385
Gene name
LocationContig_188:19826..22656
Strand+
Gene length (bp)2830
Transcript length (bp)2535
Coding sequence length (bp)2535
Protein length (aa) 845

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 3.0E-67 18 345
PF03764 EFG_IV Elongation factor G, domain IV 4.4E-32 606 721
PF00679 EFG_C Elongation factor G C-terminus 3.1E-21 725 807
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 2.2E-12 395 471
PF14492 EFG_II Elongation Factor G, domain II 1.8E-11 488 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 1 844 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 1 844 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 1 844 0.0E+00
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 1 844 0.0E+00
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 1 844 0.0E+00
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 1 844 0.0E+00
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 1 844 0.0E+00
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 1 844 0.0E+00
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 1 844 0.0E+00
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 1 844 0.0E+00
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 1 844 0.0E+00
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 1 844 0.0E+00
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 1 844 0.0E+00
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 1 844 0.0E+00
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 1 844 0.0E+00
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 1 844 0.0E+00
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 1 844 0.0E+00
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 1 844 0.0E+00
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 1 844 0.0E+00
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 1 844 0.0E+00
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 1 844 0.0E+00
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 4 842 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 4 842 0.0E+00
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 11 843 3.0E-173
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 6 840 5.0E-146
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 7 838 5.0E-144
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 6 844 9.0E-144
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 6 841 3.0E-138
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 6 794 1.0E-137
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 6 794 4.0E-136
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 6 794 4.0E-136
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 6 794 9.0E-135
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 6 833 7.0E-124
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 6 840 5.0E-123
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 6 840 1.0E-122
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 6 833 2.0E-122
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 6 833 9.0E-122
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 6 833 1.0E-119
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 6 840 1.0E-114
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 6 833 1.0E-113
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 7 833 6.0E-110
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 330 840 4.0E-100
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 329 839 1.0E-98
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 330 840 2.0E-96
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 329 840 1.0E-95
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 329 842 3.0E-95
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 337 840 7.0E-94
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 329 840 1.0E-93
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 330 840 2.0E-93
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 330 840 2.0E-93
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 312 840 4.0E-93
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 329 842 2.0E-92
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 329 842 6.0E-92
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 329 842 8.0E-92
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 329 842 9.0E-92
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 306 833 3.0E-90
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 4 830 2.0E-88
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 330 840 2.0E-88
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 330 840 1.0E-87
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 307 840 7.0E-87
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 325 835 7.0E-87
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 306 842 4.0E-86
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 330 840 2.0E-85
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 330 840 2.0E-85
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 329 840 4.0E-85
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 264 840 4.0E-85
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 312 840 7.0E-85
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 330 840 1.0E-84
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 330 843 4.0E-84
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 325 794 2.0E-83
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 330 844 9.0E-83
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 330 840 1.0E-82
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 330 840 2.0E-82
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 306 840 2.0E-82
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 325 830 4.0E-82
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 330 835 2.0E-80
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 330 835 2.0E-80
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 325 794 4.0E-80
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 335 841 7.0E-79
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 306 841 9.0E-79
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 10 387 7.0E-77
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 335 841 2.0E-76
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 330 833 4.0E-76
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 1 393 7.0E-74
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 1 386 1.0E-73
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 306 841 2.0E-73
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 359 839 6.0E-63
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 17 806 6.0E-57
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 17 808 2.0E-56
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 8 224 2.0E-54
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 5 224 5.0E-53
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 5 224 7.0E-53
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 6 257 9.0E-53
sp|B0S0I4|EFG_FINM2 Elongation factor G OS=Finegoldia magna (strain ATCC 29328) GN=fusA PE=3 SV=1 18 806 1.0E-52
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 5 224 3.0E-52
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 6 244 3.0E-52
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 6 300 4.0E-52
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 5 226 6.0E-52
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 6 237 9.0E-52
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 5 224 2.0E-51
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 5 245 2.0E-51
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 6 236 2.0E-51
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 6 236 2.0E-51
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 6 236 4.0E-51
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 5 224 5.0E-51
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 6 224 6.0E-51
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 6 224 2.0E-50
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 6 237 2.0E-50
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 6 244 3.0E-50
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 6 224 1.0E-49
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 1 224 2.0E-49
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 1 224 4.0E-49
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 11 807 5.0E-49
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 6 237 1.0E-48
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 6 224 1.0E-48
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 11 807 1.0E-48
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 1 224 2.0E-48
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 1 224 2.0E-48
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 1 224 3.0E-48
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 1 224 5.0E-48
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 12 224 6.0E-48
sp|B3EUF3|EFG_AMOA5 Elongation factor G OS=Amoebophilus asiaticus (strain 5a2) GN=fusA PE=3 SV=1 19 806 7.0E-47
sp|A5USJ2|EFG_ROSS1 Elongation factor G OS=Roseiflexus sp. (strain RS-1) GN=fusA PE=3 SV=1 18 806 8.0E-47
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 13 806 9.0E-47
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 19 228 1.0E-46
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 19 228 3.0E-46
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 1 224 7.0E-46
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 15 806 8.0E-46
sp|Q12SW2|EFG1_SHEDO Elongation factor G 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fusA1 PE=3 SV=1 20 793 3.0E-45
sp|Q9ZEU4|EFG_APPPP Elongation factor G OS=Apple proliferation phytoplasma GN=fusA PE=3 SV=1 20 793 8.0E-45
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 19 806 9.0E-45
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 6 264 2.0E-44
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 1 224 3.0E-44
sp|Q0I0A8|EFG1_SHESR Elongation factor G 1 OS=Shewanella sp. (strain MR-7) GN=fusA1 PE=3 SV=1 20 793 3.0E-44
sp|Q0HNU0|EFG1_SHESM Elongation factor G 1 OS=Shewanella sp. (strain MR-4) GN=fusA1 PE=3 SV=1 20 793 3.0E-44
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 6 224 6.0E-44
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 6 224 1.0E-43
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 6 244 1.0E-43
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 6 224 1.0E-43
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 19 806 1.0E-43
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 6 224 2.0E-43
sp|Q089Q7|EFG1_SHEFN Elongation factor G 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=fusA1 PE=3 SV=1 20 793 8.0E-43
sp|A2BYN5|EFG_PROM5 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9515) GN=fusA PE=3 SV=1 19 806 4.0E-41
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 7 227 5.0E-41
sp|Q5E8B9|EFG1_VIBF1 Elongation factor G 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fusA1 PE=3 SV=1 20 793 7.0E-41
sp|A9NEN3|EFG_ACHLI Elongation factor G OS=Acholeplasma laidlawii (strain PG-8A) GN=fusA PE=3 SV=1 20 576 1.0E-40
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 21 224 2.0E-39
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 390 687 2.0E-39
sp|Q253F1|EFG_CHLFF Elongation factor G OS=Chlamydophila felis (strain Fe/C-56) GN=fusA PE=3 SV=1 17 793 2.0E-39
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 18 571 2.0E-38
sp|Q5L6S5|EFG_CHLAB Elongation factor G OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=fusA PE=3 SV=1 17 793 7.0E-38
sp|B8HVR8|EFG_CYAP4 Elongation factor G OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fusA PE=3 SV=1 19 806 1.0E-37
sp|P39677|RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF2 PE=1 SV=1 17 752 4.0E-36
sp|B3LQ11|RRF2M_YEAS1 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF2 PE=3 SV=1 17 752 4.0E-36
sp|A6ZQM4|RRF2M_YEAS7 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF2 PE=3 SV=1 17 752 5.0E-36
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 17 568 3.0E-35
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 397 575 6.0E-35
sp|Q0SMG2|EFG2_BORAP Elongation factor G 2 OS=Borrelia afzelii (strain PKo) GN=fusA2 PE=3 SV=1 19 803 3.0E-34
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 17 569 1.0E-33
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 17 569 1.0E-33
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 17 569 2.0E-32
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 17 569 2.0E-32
sp|Q9Z802|EFG_CHLPN Elongation factor G OS=Chlamydia pneumoniae GN=fusA PE=3 SV=1 17 592 2.0E-32
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 17 573 1.0E-31
sp|Q9PJV6|EFG_CHLMU Elongation factor G OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fusA PE=3 SV=1 19 572 2.0E-31
sp|Q8R2Q4|RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus GN=Gfm2 PE=1 SV=2 6 819 3.0E-31
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 335 806 3.0E-29
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 398 819 4.0E-29
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 398 819 4.0E-29
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 398 819 4.0E-29
sp|P28371|EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusA PE=1 SV=2 335 828 9.0E-29
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 335 806 2.0E-28
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 335 806 3.0E-28
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 18 180 2.0E-27
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 18 168 2.0E-27
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 398 806 3.0E-27
sp|Q1R0H8|EFG_CHRSD Elongation factor G OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fusA PE=3 SV=1 334 806 4.0E-27
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 13 165 4.0E-27
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 13 165 4.0E-27
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 13 165 4.0E-27
sp|Q8PC52|EFG_XANCP Elongation factor G OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fusA PE=3 SV=1 334 818 5.0E-27
sp|B0RU85|EFG_XANCB Elongation factor G OS=Xanthomonas campestris pv. campestris (strain B100) GN=fusA PE=3 SV=1 334 818 5.0E-27
sp|Q4URD6|EFG_XANC8 Elongation factor G OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fusA PE=3 SV=1 334 818 5.0E-27
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 334 806 8.0E-27
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 335 806 8.0E-27
sp|Q10W80|EFG2_TRIEI Elongation factor G 2 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA2 PE=3 SV=1 335 807 8.0E-27
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 398 806 1.0E-26
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 335 806 1.0E-26
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 14 163 2.0E-26
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 398 806 2.0E-26
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 17 221 2.0E-26
sp|Q8DCQ8|EFG_VIBVU Elongation factor G OS=Vibrio vulnificus (strain CMCP6) GN=fusA PE=3 SV=1 334 804 2.0E-26
sp|Q7MH42|EFG1_VIBVY Elongation factor G 1 OS=Vibrio vulnificus (strain YJ016) GN=fusA1 PE=3 SV=1 334 804 2.0E-26
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 18 163 3.0E-26
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 334 818 3.0E-26
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 18 176 3.0E-26
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 334 818 4.0E-26
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 335 806 4.0E-26
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 18 188 5.0E-26
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 17 176 6.0E-26
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 398 806 7.0E-26
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 12 163 8.0E-26
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 18 163 8.0E-26
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 12 163 8.0E-26
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 398 806 1.0E-25
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 398 806 1.0E-25
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 12 163 1.0E-25
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 398 806 1.0E-25
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 7 163 1.0E-25
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 398 806 1.0E-25
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 18 180 1.0E-25
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 18 163 1.0E-25
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 393 806 1.0E-25
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 398 806 1.0E-25
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 398 806 1.0E-25
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 398 806 1.0E-25
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 18 163 1.0E-25
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 334 793 2.0E-25
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 335 806 2.0E-25
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 13 163 2.0E-25
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 398 793 3.0E-25
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 18 163 3.0E-25
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 16 180 3.0E-25
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 398 793 3.0E-25
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 398 806 3.0E-25
sp|B9DKV7|EFG_STACT Elongation factor G OS=Staphylococcus carnosus (strain TM300) GN=fusA PE=3 SV=1 398 806 3.0E-25
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 398 793 3.0E-25
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 14 163 3.0E-25
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 335 819 4.0E-25
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 18 163 4.0E-25
sp|Q4DKF7|GUF11_TRYCC Translation factor GUF1 homolog 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503697.90 PE=3 SV=1 16 179 5.0E-25
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 335 818 5.0E-25
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 17 163 5.0E-25
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 14 163 5.0E-25
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 16 164 5.0E-25
sp|A7H311|LEPA_CAMJD Elongation factor 4 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|Q4DZ91|GUF12_TRYCC Translation factor GUF1 homolog 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504105.210 PE=3 SV=1 16 179 6.0E-25
sp|Q5HU70|LEPA_CAMJR Elongation factor 4 OS=Campylobacter jejuni (strain RM1221) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|A5IZ33|EFG_MYCAP Elongation factor G OS=Mycoplasma agalactiae (strain PG2) GN=fusA PE=3 SV=1 398 806 6.0E-25
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 18 175 6.0E-25
sp|A1W018|LEPA_CAMJJ Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|Q9PNR1|LEPA_CAMJE Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|A8FM79|LEPA_CAMJ8 Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 16 164 6.0E-25
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|Q2S909|EFG1_HAHCH Elongation factor G 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fusA1 PE=3 SV=1 334 806 7.0E-25
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 19 176 7.0E-25
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 14 176 7.0E-25
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 14 176 8.0E-25
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 14 176 8.0E-25
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 18 163 8.0E-25
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 14 163 8.0E-25
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 14 163 8.0E-25
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 14 176 9.0E-25
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 14 163 9.0E-25
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 14 163 9.0E-25
sp|B8G6S9|EFG_CHLAD Elongation factor G OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fusA PE=3 SV=1 335 806 9.0E-25
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 17 163 1.0E-24
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 13 163 1.0E-24
sp|B9LJC8|EFG_CHLSY Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fusA PE=3 SV=1 335 806 1.0E-24
sp|A9WH62|EFG_CHLAA Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fusA PE=3 SV=1 335 806 1.0E-24
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 14 176 1.0E-24
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 398 806 1.0E-24
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 13 225 1.0E-24
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 19 163 2.0E-24
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|Q8K9Q9|LEPA_BUCAP Elongation factor 4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lepA PE=3 SV=1 12 163 2.0E-24
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 17 163 2.0E-24
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 18 219 2.0E-24
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 17 163 2.0E-24
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 12 163 2.0E-24
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 12 163 2.0E-24
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 19 163 2.0E-24
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 14 176 2.0E-24
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 14 176 2.0E-24
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 17 163 2.0E-24
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 17 163 2.0E-24
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 13 163 2.0E-24
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 17 176 2.0E-24
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 371 806 2.0E-24
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 19 163 2.0E-24
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 19 221 3.0E-24
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 13 163 3.0E-24
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 19 163 3.0E-24
sp|B1ZC10|LEPA_METPB Elongation factor 4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 16 196 3.0E-24
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 14 163 3.0E-24
sp|Q4FNH3|LEPA_PELUB Elongation factor 4 OS=Pelagibacter ubique (strain HTCC1062) GN=lepA PE=3 SV=1 13 176 3.0E-24
sp|B9KD01|LEPA_CAMLR Elongation factor 4 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 6 163 4.0E-24
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 14 163 4.0E-24
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 18 180 4.0E-24
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 17 163 4.0E-24
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 8 180 4.0E-24
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 2 163 4.0E-24
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 335 806 4.0E-24
sp|B3PME9|EFG_MYCA5 Elongation factor G OS=Mycoplasma arthritidis (strain 158L3-1) GN=fusA PE=3 SV=1 398 834 4.0E-24
sp|P44910|TYPA_HAEIN GTP-binding protein TypA/BipA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=typA PE=1 SV=1 19 164 4.0E-24
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 18 176 5.0E-24
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 18 163 5.0E-24
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 19 163 5.0E-24
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 19 163 5.0E-24
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 18 163 5.0E-24
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 17 163 6.0E-24
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 19 163 6.0E-24
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 17 163 6.0E-24
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 14 163 6.0E-24
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 335 818 6.0E-24
sp|Q3ATB2|LEPA_CHLCH Elongation factor 4 OS=Chlorobium chlorochromatii (strain CaD3) GN=lepA PE=3 SV=1 17 163 6.0E-24
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 1 163 6.0E-24
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 9 163 6.0E-24
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 12 163 6.0E-24
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 395 806 6.0E-24
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 12 163 6.0E-24
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 633 839 7.0E-24
sp|Q89AC9|TYPA_BUCBP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=typA PE=3 SV=2 18 164 7.0E-24
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 13 163 7.0E-24
sp|A0M6M2|LEPA_GRAFK Elongation factor 4 OS=Gramella forsetii (strain KT0803) GN=lepA PE=3 SV=1 18 163 8.0E-24
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 16 176 8.0E-24
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 18 163 8.0E-24
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 18 163 8.0E-24
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 18 163 9.0E-24
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 18 163 9.0E-24
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 19 163 9.0E-24
sp|Q5H1R5|LEPA_XANOR Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lepA PE=3 SV=1 14 176 1.0E-23
sp|Q2P4M4|LEPA_XANOM Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lepA PE=3 SV=1 14 176 1.0E-23
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|Q21BS0|LEPA_RHOPB Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB18) GN=lepA PE=3 SV=2 17 163 1.0E-23
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|Q5R104|LEPA_IDILO Elongation factor 4 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lepA PE=3 SV=1 15 163 1.0E-23
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 9 163 1.0E-23
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 335 806 1.0E-23
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 13 163 1.0E-23
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 18 163 1.0E-23
sp|B7KR78|LEPA_METC4 Elongation factor 4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|C0RJK4|EFG_BRUMB Elongation factor G OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fusA PE=3 SV=1 371 806 1.0E-23
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 18 176 1.0E-23
sp|B4SBG4|LEPA_PELPB Elongation factor 4 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lepA PE=3 SV=1 17 163 1.0E-23
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 8 163 2.0E-23
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 13 163 2.0E-23
sp|B2SRY0|LEPA_XANOP Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lepA PE=3 SV=1 18 176 2.0E-23
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 18 163 2.0E-23
sp|Q2NJE6|LEPA_AYWBP Elongation factor 4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lepA PE=3 SV=1 9 255 2.0E-23
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 13 163 2.0E-23
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 13 163 2.0E-23
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 14 163 2.0E-23
sp|Q839G9|EFG_ENTFA Elongation factor G OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fusA PE=3 SV=1 361 806 2.0E-23
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 15 163 2.0E-23
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 12 163 2.0E-23
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 13 163 2.0E-23
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 16 163 2.0E-23
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 12 176 2.0E-23
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 12 176 2.0E-23
sp|Q6FZB9|EFG_BARQU Elongation factor G OS=Bartonella quintana (strain Toulouse) GN=fusA PE=3 SV=1 335 816 2.0E-23
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 18 180 2.0E-23
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 12 163 2.0E-23
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 15 163 2.0E-23
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 15 163 2.0E-23
sp|Q8KQB3|EFG_BARHE Elongation factor G OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fusA PE=3 SV=1 335 816 2.0E-23
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 17 163 2.0E-23
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|A4S3R2|GUF1_OSTLU Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_88434 PE=3 SV=1 5 187 3.0E-23
sp|Q38BU9|GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.4600 PE=3 SV=1 16 166 3.0E-23
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 335 819 3.0E-23
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 12 163 3.0E-23
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 17 176 3.0E-23
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|Q8EWZ9|LEPA_MYCPE Elongation factor 4 OS=Mycoplasma penetrans (strain HF-2) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 18 165 3.0E-23
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 17 163 3.0E-23
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 13 176 3.0E-23
sp|Q2SSF7|LEPA_MYCCT Elongation factor 4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 17 163 3.0E-23
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 17 170 4.0E-23
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 18 163 4.0E-23
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 13 163 4.0E-23
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 13 163 4.0E-23
sp|Q00ZZ1|GUF1_OSTTA Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus tauri GN=Ot10g01840 PE=3 SV=1 20 163 4.0E-23
sp|A1SSM6|LEPA_PSYIN Elongation factor 4 OS=Psychromonas ingrahamii (strain 37) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 15 163 4.0E-23
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|B1YKS5|LEPA_EXIS2 Elongation factor 4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=lepA PE=3 SV=1 13 163 4.0E-23
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 19 163 4.0E-23
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 17 163 4.0E-23
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 17 163 4.0E-23
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 19 163 4.0E-23
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 17 163 4.0E-23
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 19 179 5.0E-23
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 19 180 5.0E-23
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 19 163 5.0E-23
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 18 176 5.0E-23
sp|C5CSF2|LEPA_VARPS Elongation factor 4 OS=Variovorax paradoxus (strain S110) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 12 163 5.0E-23
sp|Q1IXW5|LEPA_DEIGD Elongation factor 4 OS=Deinococcus geothermalis (strain DSM 11300) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 19 164 5.0E-23
sp|A1K601|LEPA_AZOSB Elongation factor 4 OS=Azoarcus sp. (strain BH72) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|Q57CQ5|EFG_BRUAB Elongation factor G OS=Brucella abortus biovar 1 (strain 9-941) GN=fusA PE=3 SV=1 371 806 5.0E-23
sp|Q2YM00|EFG_BRUA2 Elongation factor G OS=Brucella abortus (strain 2308) GN=fusA PE=3 SV=1 371 806 5.0E-23
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 20 178 5.0E-23
sp|A4G6S1|LEPA_HERAR Elongation factor 4 OS=Herminiimonas arsenicoxydans GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|Q8G075|EFG_BRUSU Elongation factor G OS=Brucella suis biovar 1 (strain 1330) GN=fusA PE=3 SV=1 371 806 5.0E-23
sp|A9M5Q3|EFG_BRUC2 Elongation factor G OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fusA PE=3 SV=1 371 806 5.0E-23
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 13 168 5.0E-23
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 15 163 5.0E-23
sp|Q2NS11|LEPA_SODGM Elongation factor 4 OS=Sodalis glossinidius (strain morsitans) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 16 187 6.0E-23
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 19 163 6.0E-23
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 9 163 6.0E-23
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 9 163 6.0E-23
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 15 163 6.0E-23
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 16 163 6.0E-23
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 9 163 6.0E-23
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 16 163 6.0E-23
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 7 163 6.0E-23
sp|B4S9B7|LEPA_PROA2 Elongation factor 4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=lepA PE=3 SV=1 19 163 6.0E-23
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 14 176 6.0E-23
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 20 172 7.0E-23
sp|Q6F9B9|LEPA_ACIAD Elongation factor 4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|B3QZH4|EFG_PHYMT Elongation factor G OS=Phytoplasma mali (strain AT) GN=fusA PE=3 SV=1 335 793 7.0E-23
sp|Q6KHS5|EFG_MYCMO Elongation factor G OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=fusA PE=3 SV=1 398 806 7.0E-23
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 19 176 7.0E-23
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A1JKK1|LEPA_YERE8 Elongation factor 4 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 13 163 7.0E-23
sp|A9IW31|EFG_BART1 Elongation factor G OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fusA PE=3 SV=1 335 816 7.0E-23
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 12 163 7.0E-23
sp|B0VCT7|LEPA_ACIBY Elongation factor 4 OS=Acinetobacter baumannii (strain AYE) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|A3M7P5|LEPA_ACIBT Elongation factor 4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lepA PE=3 SV=2 18 163 8.0E-23
sp|B2HWQ2|LEPA_ACIBC Elongation factor 4 OS=Acinetobacter baumannii (strain ACICU) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|B7I580|LEPA_ACIB5 Elongation factor 4 OS=Acinetobacter baumannii (strain AB0057) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|B7GYS7|LEPA_ACIB3 Elongation factor 4 OS=Acinetobacter baumannii (strain AB307-0294) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 18 163 8.0E-23
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 19 164 8.0E-23
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 19 164 8.0E-23
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 19 164 8.0E-23
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 19 164 8.0E-23
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 19 164 8.0E-23
sp|C4K3Z1|LEPA_HAMD5 Elongation factor 4 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=lepA PE=3 SV=1 20 163 8.0E-23
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 20 202 8.0E-23
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 19 163 8.0E-23
sp|B0VTM2|LEPA_ACIBS Elongation factor 4 OS=Acinetobacter baumannii (strain SDF) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|Q2YB00|EFG_NITMU Elongation factor G OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fusA PE=3 SV=1 334 806 8.0E-23
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 17 163 8.0E-23
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 18 215 8.0E-23
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 18 215 8.0E-23
sp|A5CWJ4|LEPA_VESOH Elongation factor 4 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 18 165 8.0E-23
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 18 163 8.0E-23
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 19 164 9.0E-23
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 18 163 9.0E-23
sp|C5CCD4|LEPA_MICLC Elongation factor 4 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lepA PE=3 SV=1 16 163 9.0E-23
sp|P0A1W4|LEPA_SALTY Elongation factor 4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|P0A1W5|LEPA_SALTI Elongation factor 4 OS=Salmonella typhi GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B4TS16|LEPA_SALSV Elongation factor 4 OS=Salmonella schwarzengrund (strain CVM19633) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B4T1G0|LEPA_SALNS Elongation factor 4 OS=Salmonella newport (strain SL254) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B4TE17|LEPA_SALHS Elongation factor 4 OS=Salmonella heidelberg (strain SL476) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B5QTV0|LEPA_SALEP Elongation factor 4 OS=Salmonella enteritidis PT4 (strain P125109) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B5FRC7|LEPA_SALDC Elongation factor 4 OS=Salmonella dublin (strain CT_02021853) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q57LC8|LEPA_SALCH Elongation factor 4 OS=Salmonella choleraesuis (strain SC-B67) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B5F1G3|LEPA_SALA4 Elongation factor 4 OS=Salmonella agona (strain SL483) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|A4WDE0|LEPA_ENT38 Elongation factor 4 OS=Enterobacter sp. (strain 638) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 19 176 9.0E-23
sp|A5VR09|EFG_BRUO2 Elongation factor G OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fusA PE=3 SV=1 371 806 9.0E-23
sp|B5BAS8|LEPA_SALPK Elongation factor 4 OS=Salmonella paratyphi A (strain AKU_12601) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q5PNC0|LEPA_SALPA Elongation factor 4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B5RD51|LEPA_SALG2 Elongation factor 4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 17 163 9.0E-23
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 17 163 9.0E-23
sp|C0PYG5|LEPA_SALPC Elongation factor 4 OS=Salmonella paratyphi C (strain RKS4594) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q8YHP3|EFG_BRUME Elongation factor G OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fusA PE=3 SV=1 371 806 9.0E-23
sp|A8GRF6|LEPA_RICRS Elongation factor 4 OS=Rickettsia rickettsii (strain Sheila Smith) GN=lepA PE=3 SV=1 13 163 9.0E-23
sp|B0BWV5|LEPA_RICRO Elongation factor 4 OS=Rickettsia rickettsii (strain Iowa) GN=lepA PE=3 SV=1 13 163 9.0E-23
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|A4TKY0|LEPA_YERPP Elongation factor 4 OS=Yersinia pestis (strain Pestoides F) GN=lepA PE=3 SV=1 17 163 9.0E-23
sp|A9MGX5|LEPA_SALAR Elongation factor 4 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 20 202 1.0E-22
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 18 163 1.0E-22
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 395 806 3.0E-22
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 395 806 3.0E-22
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 20 164 6.0E-22
sp|B3QZH4|EFG_PHYMT Elongation factor G OS=Phytoplasma mali (strain AT) GN=fusA PE=3 SV=1 20 178 6.0E-22
sp|B3PME9|EFG_MYCA5 Elongation factor G OS=Mycoplasma arthritidis (strain 158L3-1) GN=fusA PE=3 SV=1 15 176 1.0E-21
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 17 164 2.0E-21
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 17 170 2.0E-21
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 20 188 3.0E-21
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 17 164 3.0E-21
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 20 164 5.0E-21
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 18 164 5.0E-21
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 17 193 5.0E-21
sp|Q2YB00|EFG_NITMU Elongation factor G OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fusA PE=3 SV=1 20 165 5.0E-21
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 20 188 6.0E-21
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 20 164 6.0E-21
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 20 164 6.0E-21
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 20 164 6.0E-21
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 20 193 6.0E-21
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 18 164 7.0E-21
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 13 164 8.0E-21
sp|A5IZ33|EFG_MYCAP Elongation factor G OS=Mycoplasma agalactiae (strain PG2) GN=fusA PE=3 SV=1 11 209 8.0E-21
sp|Q1R0H8|EFG_CHRSD Elongation factor G OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fusA PE=3 SV=1 20 165 9.0E-21
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 20 176 1.0E-20
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 18 209 1.0E-20
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 18 209 1.0E-20
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 18 209 1.0E-20
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 20 193 1.0E-20
sp|Q6KHS5|EFG_MYCMO Elongation factor G OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=fusA PE=3 SV=1 18 165 1.0E-20
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 17 244 2.0E-20
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 17 244 2.0E-20
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 17 244 2.0E-20
sp|B9DKV7|EFG_STACT Elongation factor G OS=Staphylococcus carnosus (strain TM300) GN=fusA PE=3 SV=1 20 191 2.0E-20
sp|Q839G9|EFG_ENTFA Elongation factor G OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fusA PE=3 SV=1 20 196 3.0E-20
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 13 164 4.0E-20
sp|Q2S909|EFG1_HAHCH Elongation factor G 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fusA1 PE=3 SV=1 20 165 4.0E-20
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 13 164 4.0E-20
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 13 164 5.0E-20
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 13 164 7.0E-20
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 704 839 1.0E-19
sp|B9LJC8|EFG_CHLSY Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fusA PE=3 SV=1 18 203 1.0E-18
sp|A9WH62|EFG_CHLAA Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fusA PE=3 SV=1 18 203 1.0E-18
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 20 164 6.0E-18
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 20 170 6.0E-18
sp|B8G6S9|EFG_CHLAD Elongation factor G OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fusA PE=3 SV=1 18 164 7.0E-18
sp|Q10W80|EFG2_TRIEI Elongation factor G 2 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA2 PE=3 SV=1 17 164 1.0E-17
sp|Q8DCQ8|EFG_VIBVU Elongation factor G OS=Vibrio vulnificus (strain CMCP6) GN=fusA PE=3 SV=1 20 165 1.0E-17
sp|Q7MH42|EFG1_VIBVY Elongation factor G 1 OS=Vibrio vulnificus (strain YJ016) GN=fusA1 PE=3 SV=1 20 165 1.0E-17
sp|Q8PC52|EFG_XANCP Elongation factor G OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fusA PE=3 SV=1 20 164 2.0E-17
sp|B0RU85|EFG_XANCB Elongation factor G OS=Xanthomonas campestris pv. campestris (strain B100) GN=fusA PE=3 SV=1 20 164 2.0E-17
sp|Q4URD6|EFG_XANC8 Elongation factor G OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fusA PE=3 SV=1 20 164 2.0E-17
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 20 164 2.0E-17
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 20 164 2.0E-17
sp|A9IW31|EFG_BART1 Elongation factor G OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fusA PE=3 SV=1 15 164 2.0E-17
sp|Q8KQB3|EFG_BARHE Elongation factor G OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fusA PE=3 SV=1 15 164 3.0E-17
sp|Q6FZB9|EFG_BARQU Elongation factor G OS=Bartonella quintana (strain Toulouse) GN=fusA PE=3 SV=1 15 164 4.0E-17
sp|C0RJK4|EFG_BRUMB Elongation factor G OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|Q57CQ5|EFG_BRUAB Elongation factor G OS=Brucella abortus biovar 1 (strain 9-941) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|Q2YM00|EFG_BRUA2 Elongation factor G OS=Brucella abortus (strain 2308) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|Q8G075|EFG_BRUSU Elongation factor G OS=Brucella suis biovar 1 (strain 1330) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|A9M5Q3|EFG_BRUC2 Elongation factor G OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|A5VR09|EFG_BRUO2 Elongation factor G OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|Q8YHP3|EFG_BRUME Elongation factor G OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fusA PE=3 SV=1 15 164 5.0E-17
sp|P28371|EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusA PE=1 SV=2 17 164 3.0E-15
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 295 816 3.0E-14
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 663 806 2.0E-10
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 663 806 2.0E-10
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 663 806 2.0E-10
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 663 806 2.0E-10
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 663 806 1.0E-09
sp|A9NEN3|EFG_ACHLI Elongation factor G OS=Acholeplasma laidlawii (strain PG-8A) GN=fusA PE=3 SV=1 721 806 2.0E-07
sp|Q9Z802|EFG_CHLPN Elongation factor G OS=Chlamydia pneumoniae GN=fusA PE=3 SV=1 721 793 2.0E-07
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 721 793 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3385
MVNFTIDEIRALMDKPSNVRNMSVIAHVDHGKSTLTDSLLAKAGIISTAKAGDARATDTRSDEQERGITIKSTAI
SLYGHLEDPEDVKDIVGQKTDGQDFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALG
ERIKPVVIINKVDRALLELQVSKEDLYQSFSRTIESVNVIISTYLDKSLGDVQVYPYKGTVAFGSGLHGWAFTIR
QFAVRYAKKFGVDKNKMMERLWGDNYFNPHTKKWTKSDTYEGKPLERAFNQFILDPIFKIFSAVMNFKKEETATL
LEKLNLKLNTEDKQKEGKQLLKAVMRTFLPAADSLLEMMILHLPSPVTAQKYRVETLYEGPLDDDAAVGIRDCDP
KGPLMLYVSKMVPTSDKGRFYAFGRVFSGTVRSGLKVRIQGPNYVPGKKEDLFIKAIQRTVLMMGGKVEPIDDMP
AGNIVGLVGIDQFLLKSGTLTTSDTAHNLKVMKFSVSPVVQRSVQVKNAQDLPKLVEGLKRLSKSDPCVLTYTSE
SGEHVVAGAGELHLEICLKDLEEDHAGVPLMISDPVVQYRETVQGKSSITALSKSPNKHNRLYMVAEPISEDLSL
AIEAGKVSARDDFKARARVLADDFGWDVTDARKIWTFGPDGTGANLLVDQTKAVQYLNEIKDSVVSGFQWASREG
PVAEEPMRSIRFNILDVTLHADAIHRGGGQIIPTARRVLYASALLAEPALLEPVYLVEIQVPEQAMGGVYGVLTR
RRGHVFNEEQRPGTPLFNIKAYLPVLESFGFNGDLRQATSGQAFPQSVFDHWQVLPGGSPLDSTSKTGQIVTEMR
KRKGIKVEVPGVENYYDKL*
Coding >Hirsu2|3385
ATGGTCAACTTCACTATCGACGAGATCCGGGCCTTGATGGACAAGCCCAGCAATGTCCGCAACATGTCCGTCATC
GCCCACGTCGACCACGGAAAGTCCACCTTGACCGACTCTCTCCTTGCCAAGGCCGGCATCATCTCCACGGCAAAG
GCCGGCGACGCTCGAGCGACAGATACTCGTTCCGACGAGCAGGAGCGCGGCATTACCATCAAGTCGACGGCCATC
TCCCTCTACGGCCATCTCGAGGACCCCGAGGACGTCAAGGACATCGTCGGCCAGAAGACGGACGGCCAGGACTTC
CTCATCAACCTCATTGATTCGCCAGGCCACGTCGACTTCTCCTCCGAAGTCACCGCCGCCCTGCGTGTCACCGAT
GGCGCTCTCGTCGTCGTCGACACCGTCGAAGGCGTCTGCGTCCAGACCGAGACTGTCCTGCGACAGGCCCTCGGC
GAGCGCATCAAGCCCGTCGTCATCATCAACAAGGTCGACCGCGCCCTTCTCGAGCTCCAGGTCTCCAAGGAGGAC
CTGTACCAGTCCTTCTCGCGAACCATCGAGTCCGTCAACGTCATTATCTCCACCTACCTCGACAAGTCCCTCGGC
GACGTCCAGGTCTACCCCTACAAGGGCACCGTCGCCTTCGGCTCCGGTCTGCACGGCTGGGCCTTCACCATCCGC
CAGTTCGCCGTCCGCTACGCCAAGAAGTTCGGCGTCGACAAGAACAAGATGATGGAGCGTCTCTGGGGTGACAAC
TACTTCAACCCCCACACCAAGAAGTGGACCAAGAGCGACACCTACGAGGGCAAGCCTCTCGAGCGTGCCTTCAAC
CAGTTCATCCTGGACCCCATCTTCAAGATCTTCTCCGCCGTCATGAACTTCAAGAAGGAGGAGACGGCCACGCTG
CTGGAGAAGCTCAACCTCAAGCTCAACACCGAGGACAAGCAAAAGGAGGGCAAGCAGCTGCTCAAGGCCGTCATG
CGCACCTTCCTCCCCGCTGCCGACTCCCTGCTGGAGATGATGATCCTGCACCTGCCCTCGCCCGTCACGGCCCAG
AAGTACCGTGTCGAGACGCTCTACGAGGGTCCCCTTGACGACGATGCCGCCGTTGGCATCCGCGACTGCGACCCC
AAGGGCCCCCTCATGCTCTACGTCTCCAAGATGGTGCCCACCTCGGACAAGGGTCGCTTCTACGCCTTCGGCCGT
GTCTTCTCCGGTACCGTCCGCTCCGGCCTCAAGGTCCGCATCCAGGGCCCCAACTACGTGCCCGGCAAGAAGGAG
GACCTCTTCATCAAGGCCATCCAGCGAACCGTCCTCATGATGGGCGGCAAGGTCGAGCCCATCGACGACATGCCC
GCCGGCAACATCGTCGGCCTCGTCGGCATCGACCAGTTCCTGCTCAAGTCGGGAACGCTGACCACCAGCGACACG
GCCCACAACCTCAAGGTCATGAAGTTCTCCGTCTCGCCCGTCGTCCAGCGCTCCGTCCAGGTCAAGAACGCCCAG
GACCTGCCCAAGCTGGTCGAGGGTCTCAAGCGCCTGTCCAAGTCGGACCCTTGCGTCCTGACCTACACGTCCGAG
TCCGGTGAGCACGTCGTCGCCGGCGCCGGCGAGCTGCATCTCGAGATTTGCCTGAAGGATCTCGAGGAGGACCAC
GCCGGCGTTCCCCTCATGATCTCGGACCCCGTCGTCCAGTACCGCGAGACGGTCCAGGGCAAGTCGAGCATAACG
GCCCTGTCCAAGTCGCCCAACAAGCACAACCGTCTGTACATGGTGGCAGAGCCCATCTCGGAGGATCTGTCGCTT
GCCATTGAGGCGGGCAAGGTCAGCGCCCGCGACGACTTCAAGGCCCGCGCCCGCGTCCTCGCCGACGACTTCGGC
TGGGACGTGACGGACGCCCGCAAGATCTGGACCTTCGGCCCCGATGGCACCGGCGCCAACCTGCTGGTCGACCAG
ACCAAGGCCGTCCAGTACCTCAACGAAATCAAGGACTCGGTCGTCTCGGGTTTCCAATGGGCCAGCCGCGAGGGT
CCCGTTGCCGAGGAGCCGATGCGATCGATCCGATTCAACATCCTCGACGTGACGCTGCACGCCGACGCCATCCAC
CGCGGCGGCGGCCAGATCATCCCCACGGCCCGCCGTGTCCTGTACGCCTCGGCCCTGCTGGCCGAGCCGGCCCTG
CTGGAGCCCGTGTACCTGGTCGAGATTCAGGTGCCGGAGCAGGCCATGGGCGGCGTGTACGGCGTCCTGACGCGA
CGACGTGGCCACGTCTTCAACGAGGAGCAGCGCCCCGGCACGCCCCTGTTCAACATCAAGGCCTACCTGCCCGTC
CTGGAGTCGTTCGGCTTCAACGGCGACCTGCGCCAGGCCACGTCGGGCCAGGCCTTCCCCCAGTCCGTCTTCGAC
CACTGGCAGGTTTTGCCCGGCGGCTCGCCGCTGGACTCGACGTCCAAGACGGGCCAGATCGTGACGGAGATGCGC
AAGCGCAAGGGCATCAAGGTTGAGGTTCCGGGCGTTGAGAATTACTACGACAAGCTGTAA
Transcript >Hirsu2|3385
ATGGTCAACTTCACTATCGACGAGATCCGGGCCTTGATGGACAAGCCCAGCAATGTCCGCAACATGTCCGTCATC
GCCCACGTCGACCACGGAAAGTCCACCTTGACCGACTCTCTCCTTGCCAAGGCCGGCATCATCTCCACGGCAAAG
GCCGGCGACGCTCGAGCGACAGATACTCGTTCCGACGAGCAGGAGCGCGGCATTACCATCAAGTCGACGGCCATC
TCCCTCTACGGCCATCTCGAGGACCCCGAGGACGTCAAGGACATCGTCGGCCAGAAGACGGACGGCCAGGACTTC
CTCATCAACCTCATTGATTCGCCAGGCCACGTCGACTTCTCCTCCGAAGTCACCGCCGCCCTGCGTGTCACCGAT
GGCGCTCTCGTCGTCGTCGACACCGTCGAAGGCGTCTGCGTCCAGACCGAGACTGTCCTGCGACAGGCCCTCGGC
GAGCGCATCAAGCCCGTCGTCATCATCAACAAGGTCGACCGCGCCCTTCTCGAGCTCCAGGTCTCCAAGGAGGAC
CTGTACCAGTCCTTCTCGCGAACCATCGAGTCCGTCAACGTCATTATCTCCACCTACCTCGACAAGTCCCTCGGC
GACGTCCAGGTCTACCCCTACAAGGGCACCGTCGCCTTCGGCTCCGGTCTGCACGGCTGGGCCTTCACCATCCGC
CAGTTCGCCGTCCGCTACGCCAAGAAGTTCGGCGTCGACAAGAACAAGATGATGGAGCGTCTCTGGGGTGACAAC
TACTTCAACCCCCACACCAAGAAGTGGACCAAGAGCGACACCTACGAGGGCAAGCCTCTCGAGCGTGCCTTCAAC
CAGTTCATCCTGGACCCCATCTTCAAGATCTTCTCCGCCGTCATGAACTTCAAGAAGGAGGAGACGGCCACGCTG
CTGGAGAAGCTCAACCTCAAGCTCAACACCGAGGACAAGCAAAAGGAGGGCAAGCAGCTGCTCAAGGCCGTCATG
CGCACCTTCCTCCCCGCTGCCGACTCCCTGCTGGAGATGATGATCCTGCACCTGCCCTCGCCCGTCACGGCCCAG
AAGTACCGTGTCGAGACGCTCTACGAGGGTCCCCTTGACGACGATGCCGCCGTTGGCATCCGCGACTGCGACCCC
AAGGGCCCCCTCATGCTCTACGTCTCCAAGATGGTGCCCACCTCGGACAAGGGTCGCTTCTACGCCTTCGGCCGT
GTCTTCTCCGGTACCGTCCGCTCCGGCCTCAAGGTCCGCATCCAGGGCCCCAACTACGTGCCCGGCAAGAAGGAG
GACCTCTTCATCAAGGCCATCCAGCGAACCGTCCTCATGATGGGCGGCAAGGTCGAGCCCATCGACGACATGCCC
GCCGGCAACATCGTCGGCCTCGTCGGCATCGACCAGTTCCTGCTCAAGTCGGGAACGCTGACCACCAGCGACACG
GCCCACAACCTCAAGGTCATGAAGTTCTCCGTCTCGCCCGTCGTCCAGCGCTCCGTCCAGGTCAAGAACGCCCAG
GACCTGCCCAAGCTGGTCGAGGGTCTCAAGCGCCTGTCCAAGTCGGACCCTTGCGTCCTGACCTACACGTCCGAG
TCCGGTGAGCACGTCGTCGCCGGCGCCGGCGAGCTGCATCTCGAGATTTGCCTGAAGGATCTCGAGGAGGACCAC
GCCGGCGTTCCCCTCATGATCTCGGACCCCGTCGTCCAGTACCGCGAGACGGTCCAGGGCAAGTCGAGCATAACG
GCCCTGTCCAAGTCGCCCAACAAGCACAACCGTCTGTACATGGTGGCAGAGCCCATCTCGGAGGATCTGTCGCTT
GCCATTGAGGCGGGCAAGGTCAGCGCCCGCGACGACTTCAAGGCCCGCGCCCGCGTCCTCGCCGACGACTTCGGC
TGGGACGTGACGGACGCCCGCAAGATCTGGACCTTCGGCCCCGATGGCACCGGCGCCAACCTGCTGGTCGACCAG
ACCAAGGCCGTCCAGTACCTCAACGAAATCAAGGACTCGGTCGTCTCGGGTTTCCAATGGGCCAGCCGCGAGGGT
CCCGTTGCCGAGGAGCCGATGCGATCGATCCGATTCAACATCCTCGACGTGACGCTGCACGCCGACGCCATCCAC
CGCGGCGGCGGCCAGATCATCCCCACGGCCCGCCGTGTCCTGTACGCCTCGGCCCTGCTGGCCGAGCCGGCCCTG
CTGGAGCCCGTGTACCTGGTCGAGATTCAGGTGCCGGAGCAGGCCATGGGCGGCGTGTACGGCGTCCTGACGCGA
CGACGTGGCCACGTCTTCAACGAGGAGCAGCGCCCCGGCACGCCCCTGTTCAACATCAAGGCCTACCTGCCCGTC
CTGGAGTCGTTCGGCTTCAACGGCGACCTGCGCCAGGCCACGTCGGGCCAGGCCTTCCCCCAGTCCGTCTTCGAC
CACTGGCAGGTTTTGCCCGGCGGCTCGCCGCTGGACTCGACGTCCAAGACGGGCCAGATCGTGACGGAGATGCGC
AAGCGCAAGGGCATCAAGGTTGAGGTTCCGGGCGTTGAGAATTACTACGACAAGCTGTAA
Gene >Hirsu2|3385
ATGGTCAAGTAAGTCTGCTTCCCTTCCGTCTCGTCTGACGCCTCTTGCGGCCTGCCCGGGCCTCGTTGGCCTCGT
CGCGCCGTGTCGCCGAGATGCGCCCGCTCGTGTGCCCCGCTCGGGGTTGGAGGAGCCGGCCGGCTGACCCCGTCT
CTGCTCCGCGACAGCTTCACTATCGACGAGATCCGGGCCTTGATGGACAAGCCCAGCAATGTCCGCAACATGTCC
GTCATCGCCCACGTCGACCACGGAAAGTCCACCTTGACCGACTCTCTCCTTGCCAAGGCCGGCATCATCTCCACG
GCAAAGGCCGGCGACGCTCGAGCGACAGATACTCGTTCCGACGAGCAGGAGCGCGGCATTACCATCAAGTCGACG
GCCATCTCCCTCTACGGCCATCTCGAGGACCCCGAGGACGTCAAGGACATCGTCGGCCAGAAGACGGACGGCCAG
GACTTCCTCATCAACCTCATTGATTCGCCAGGCCACGTCGACTTCTCCTCCGAAGTCACCGCCGCCCTGCGTGTC
ACCGATGGCGCTCTCGTCGTCGTCGACACCGTCGAAGGCGTCTGCGTCCAGACCGAGACTGTCCTGCGACAGGCC
CTCGGCGAGCGCATCAAGCCCGTCGTCATCATCAACAAGGTCGACCGCGCCCTTCTCGAGCTCCAGGTCTCCAAG
GAGGACCTGTACCAGTCCTTCTCGCGAACCATCGAGTCCGTCAACGTCATTATCTCCACCTACCTCGACAAGTCC
CTCGGCGACGTCCAGGTCTACCCCTACAAGGGCACCGTCGCCTTCGGCTCCGGTCTGCACGGCTGGGCCTTCACC
ATCCGCCAGTTCGCCGTCCGCTACGCCAAGAAGTTCGGCGTCGACAAGAACAAGATGATGGAGCGTCTCTGGGTA
AGCCACCTCCGTCTGCTCTCCTCTGCCCCCCCCCCCCTCTCCCTCGTCTCGCTAACGTGAGTTGAATCGCGCGAC
TTCAGGGTGACAACTACTTCAACCCCCACACCAAGAAGTGGACCAAGAGCGACACCTACGAGGGCAAGCCTCTCG
AGCGTGCCTTCAACCAGTTCATCCTGGACCCCATCTTCAAGATCTTCTCCGCCGTCATGAACTTCAAGAAGGAGG
AGACGGCCACGCTGCTGGAGAAGCTCAACCTCAAGCTCAACACCGAGGACAAGCAAAAGGAGGGCAAGCAGCTGC
TCAAGGCCGTCATGCGCACCTTCCTCCCCGCTGCCGACTCCCTGCTGGAGATGATGATCCTGCACCTGCCCTCGC
CCGTCACGGCCCAGAAGTACCGTGTCGAGACGCTCTACGAGGGTCCCCTTGACGACGATGCCGCCGTTGGCATCC
GCGACTGCGACCCCAAGGGCCCCCTCATGCTCTACGTCTCCAAGATGGTGCCCACCTCGGACAAGGGTCGCTTCT
ACGCCTTCGGCCGTGTCTTCTCCGGTACCGTCCGCTCCGGCCTCAAGGTCCGCATCCAGGGCCCCAACTACGTGC
CCGGCAAGAAGGAGGACCTCTTCATCAAGGCCATCCAGCGAACCGTCCTCATGATGGGCGGCAAGGTCGAGCCCA
TCGACGACATGCCCGCCGGCAACATCGTCGGCCTCGTCGGCATCGACCAGTTCCTGCTCAAGTCGGGAACGCTGA
CCACCAGCGACACGGCCCACAACCTCAAGGTCATGAAGTTCTCCGTCTCGCCCGTCGTCCAGCGCTCCGTCCAGG
TCAAGAACGCCCAGGACCTGCCCAAGCTGGTCGAGGGTCTCAAGCGCCTGTCCAAGTCGGACCCTTGCGTCCTGA
CCTACACGTCCGAGTCCGGTGAGCACGTCGTCGCCGGCGCCGGCGAGCTGCATCTCGAGATTTGCCTGAAGGATC
TCGAGGAGGACCACGCCGGCGTTCCCCTCATGATCTCGGACCCCGTCGTCCAGTACCGCGAGACGGTCCAGGGCA
AGTCGAGCATAACGGCCCTGTCCAAGTCGCCCAACAAGCACAACCGTCTGTACATGGTGGCAGAGCCCATCTCGG
AGGATCTGTCGCTTGCCATTGAGGCGGGCAAGGTCAGCGCCCGCGACGACTTCAAGGCCCGCGCCCGCGTCCTCG
CCGACGACTTCGGCTGGGACGTGACGGACGCCCGCAAGATCTGGACCTTCGGCCCCGATGGCACCGGCGCCAACC
TGCTGGTCGACCAGACCAAGGCCGTCCAGTACCTCAACGAAATCAAGGACTCGGTCGTCTCGGGTTTCCAATGGG
CCAGCCGCGAGGGTCCCGTTGCCGAGGAGCCGATGCGATCGATCCGATTCAACATCCTCGACGTGACGCTGCACG
CCGACGCCATCCACCGCGGCGGCGGCCAGATCATCCCCACGGCCCGCCGTGTCCTGTACGCCTCGGCCCTGCTGG
CCGAGCCGGCCCTGCTGGAGCCCGTGTACCTGGTCGAGATTCAGGTGCCGGAGCAGGCCATGGGCGGCGTGTACG
GCGTCCTGACGCGACGACGTGGCCACGTCTTCAACGAGGAGCAGCGCCCCGGCACGCCCCTGTTCAACATCAAGG
CCTACCTGCCCGTCCTGGAGTCGTTCGGCTTCAACGGCGACCTGCGCCAGGCCACGTCGGGCCAGGCCTTCCCCC
AGTCCGTCTTCGACCACTGGCAGGTTTTGCCCGGCGGCTCGCCGCTGGACTCGACGTCCAAGACGGGCCAGATCG
TGACGGAGATGCGCAAGCGCAAGGGCATCAAGGTTGAGGTTCCGGGCGTTGAGAATGTAAGTGGAAGCGAGCGGA
GTTGCGAGAGCGAGGTGGCCGTGCTAACGGATCCCAGTACTACGACAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail