© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|3383 |
| Gene name | |
| Location | Contig_188:13951..15295 |
| Strand | + |
| Gene length (bp) | 1344 |
| Transcript length (bp) | 1068 |
| Coding sequence length (bp) | 1068 |
| Protein length (aa) | 356 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00107 | ADH_zinc_N | Zinc-binding dehydrogenase | 1.2E-25 | 184 | 312 |
| PF13602 | ADH_zinc_N_2 | Zinc-binding dehydrogenase | 3.6E-14 | 216 | 351 |
| PF08240 | ADH_N | Alcohol dehydrogenase GroES-like domain | 7.4E-09 | 39 | 100 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94564|YGD6_SCHPO | Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 | 17 | 354 | 2.0E-94 |
| sp|O31186|ADHA_RHIME | Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 | 13 | 308 | 1.0E-31 |
| sp|O35017|YOGA_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 | 17 | 355 | 2.0E-26 |
| sp|P49384|ADH3_KLULA | Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 | 1 | 353 | 9.0E-26 |
| sp|P42327|ADH2_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 | 24 | 355 | 2.0E-24 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O94564|YGD6_SCHPO | Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 | 17 | 354 | 2.0E-94 |
| sp|O31186|ADHA_RHIME | Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 | 13 | 308 | 1.0E-31 |
| sp|O35017|YOGA_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 | 17 | 355 | 2.0E-26 |
| sp|P49384|ADH3_KLULA | Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 | 1 | 353 | 9.0E-26 |
| sp|P42327|ADH2_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 | 24 | 355 | 2.0E-24 |
| sp|P49385|ADH4_KLULA | Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 | 4 | 353 | 1.0E-23 |
| sp|Q53FA7|QORX_HUMAN | Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 | 18 | 354 | 4.0E-23 |
| sp|P42328|ADH3_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 | 26 | 355 | 2.0E-22 |
| sp|O94038|ADH2_CANAL | Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 | 4 | 353 | 4.0E-22 |
| sp|A4YGN2|ACAR_METS5 | Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 | 14 | 350 | 5.0E-22 |
| sp|P12311|ADH1_GEOSE | Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 | 26 | 354 | 6.0E-22 |
| sp|Q9SV68|QORH_ARATH | Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 | 22 | 353 | 7.0E-22 |
| sp|Q0MVN8|QOR_PIG | Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 | 32 | 339 | 9.0E-22 |
| sp|Q3IZ91|CCR_RHOS4 | Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 | 5 | 271 | 2.0E-21 |
| sp|Q8H0M1|QORH_SPIOL | Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 | 22 | 353 | 2.0E-21 |
| sp|P11415|QOR_CAVPO | Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 | 33 | 339 | 6.0E-21 |
| sp|P49383|ADH2_KLULA | Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 | 4 | 308 | 1.0E-20 |
| sp|F2Z678|ADH2_YARLI | Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 | 32 | 308 | 2.0E-20 |
| sp|P20369|ADH1_KLULA | Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 | 1 | 308 | 2.0E-20 |
| sp|O13309|ADH2_PICST | Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 | 4 | 353 | 2.0E-20 |
| sp|P41747|ADH1_ASPFN | Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 | 4 | 340 | 3.0E-20 |
| sp|Q08257|QOR_HUMAN | Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 | 33 | 339 | 4.0E-20 |
| sp|Q5R4S7|QOR_PONAB | Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 | 33 | 339 | 7.0E-20 |
| sp|Q07288|ADH1_KLUMA | Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 | 4 | 353 | 1.0E-19 |
| sp|O00097|ADH1_PICST | Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 | 32 | 353 | 1.0E-19 |
| sp|Q9P6C8|ADH1_NEUCR | Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 | 4 | 353 | 3.0E-19 |
| sp|Q9P4C2|ADH2_KLUMA | Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 | 4 | 353 | 3.0E-19 |
| sp|Q84V25|ENOXE_FRAAN | 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 | 2 | 352 | 4.0E-19 |
| sp|Q6AYT0|QOR_RAT | Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 | 33 | 339 | 4.0E-19 |
| sp|P08843|ADH1_EMENI | Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 | 4 | 354 | 5.0E-19 |
| sp|O97764|QOR_BOVIN | Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 | 33 | 339 | 5.0E-19 |
| sp|P07246|ADH3_YEAST | Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 | 4 | 353 | 6.0E-19 |
| sp|P00331|ADH2_YEAST | Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 | 4 | 353 | 7.0E-19 |
| sp|Q975C8|ACAR_SULTO | Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 | 27 | 353 | 1.0E-18 |
| sp|P47199|QOR_MOUSE | Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 | 33 | 339 | 6.0E-18 |
| sp|O23939|ENOX_FRAVE | 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 | 2 | 352 | 6.0E-18 |
| sp|P0DN30|RTAI1_ARTBC | Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 | 4 | 354 | 1.0E-17 |
| sp|Q8BGC4|ZADH2_MOUSE | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 | 3 | 354 | 2.0E-17 |
| sp|Q9ZUC1|QORL_ARATH | Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 | 4 | 352 | 2.0E-17 |
| sp|Q941I0|ENOXC_FRAAN | 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 | 2 | 352 | 2.0E-17 |
| sp|K4BW79|ENOX_SOLLC | 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 | 4 | 352 | 4.0E-17 |
| sp|P43903|QOR_PSEAE | Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 | 37 | 224 | 4.0E-17 |
| sp|Q8NXU1|ADH_STAAW | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q6GBM4|ADH_STAAS | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q6GJ63|ADH_STAAR | Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q5HI63|ADH_STAAC | Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q2YSX0|ADH_STAAB | Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q2G0G1|ADH_STAA8 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q2FJ31|ADH_STAA3 | Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 | 30 | 353 | 5.0E-17 |
| sp|Q53865|CCR_STRCU | Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 | 20 | 352 | 6.0E-17 |
| sp|Q7A742|ADH_STAAN | Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 | 30 | 353 | 8.0E-17 |
| sp|Q99W07|ADH_STAAM | Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 | 30 | 353 | 8.0E-17 |
| sp|Q17334|ADH1_CAEEL | Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 | 1 | 345 | 9.0E-17 |
| sp|Q28452|QOR_LAMGU | Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 | 33 | 339 | 9.0E-17 |
| sp|P38113|ADH5_YEAST | Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 | 2 | 308 | 2.0E-16 |
| sp|Q6XQ67|ADH5_SACPS | Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 | 2 | 308 | 2.0E-16 |
| sp|P38230|QOR_YEAST | Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 | 1 | 277 | 2.0E-16 |
| sp|P00330|ADH1_YEAST | Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 | 4 | 353 | 3.0E-16 |
| sp|P07754|ADH3_EMENI | Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 | 32 | 354 | 4.0E-16 |
| sp|O45687|ADH2_CAEEL | Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 | 26 | 353 | 8.0E-16 |
| sp|O35045|YJMD_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 | 29 | 350 | 8.0E-16 |
| sp|A7RK30|QORL2_NEMVE | Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 | 2 | 355 | 1.0E-15 |
| sp|Q8JFV8|VAT1_DANRE | Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 | 19 | 242 | 1.0E-15 |
| sp|Q82LU9|CCRA2_STRAW | Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 | 20 | 352 | 2.0E-15 |
| sp|P43067|ADH1_CANAX | Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 | 1 | 314 | 3.0E-15 |
| sp|Q8N4Q0|ZADH2_HUMAN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 | 3 | 354 | 3.0E-15 |
| sp|P42865|QOR_LEIAM | Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 | 4 | 355 | 4.0E-15 |
| sp|Q924D0|RT4I1_MOUSE | Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 | 39 | 354 | 4.0E-15 |
| sp|Q8KQL2|ARPD_ENTAV | D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 | 22 | 305 | 9.0E-15 |
| sp|A4YGN0|SUCD_METS5 | Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 | 40 | 274 | 2.0E-14 |
| sp|P96202|PPSC_MYCTU | Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 | 40 | 354 | 3.0E-14 |
| sp|Q7TXL8|PPSC_MYCBO | Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 | 40 | 354 | 3.0E-14 |
| sp|Q0VC50|RT4I1_BOVIN | Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 | 39 | 354 | 8.0E-14 |
| sp|P28304|QOR1_ECOLI | Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 | 38 | 280 | 9.0E-14 |
| sp|Q99536|VAT1_HUMAN | Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 | 40 | 274 | 1.0E-13 |
| sp|P40783|QOR_SALTY | Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 | 38 | 339 | 2.0E-13 |
| sp|P00332|ADH_SCHPO | Alcohol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh1 PE=1 SV=2 | 22 | 241 | 2.0E-13 |
| sp|Q8WWV3|RT4I1_HUMAN | Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 | 39 | 354 | 2.0E-13 |
| sp|Q3J6K9|ACUI_RHOS4 | Acrylyl-CoA reductase AcuI OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=acuI PE=1 SV=1 | 14 | 277 | 6.0E-13 |
| sp|Q59I44|CAA43_BURSP | 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 | 37 | 277 | 8.0E-13 |
| sp|O42909|YBI2_SCHPO | Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 | 20 | 226 | 9.0E-13 |
| sp|Q03132|ERYA2_SACER | Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 | 23 | 273 | 1.0E-12 |
| sp|Q9BV79|MECR_HUMAN | Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 | 26 | 226 | 4.0E-12 |
| sp|P54202|ADH2_EMENI | Alcohol dehydrogenase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcB PE=3 SV=2 | 6 | 354 | 5.0E-12 |
| sp|Q02251|MCAS_MYCBO | Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 | 37 | 273 | 6.0E-12 |
| sp|O74489|QOR_SCHPO | Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 | 24 | 352 | 7.0E-12 |
| sp|Q0KDL6|ADH_CUPNH | Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 | 26 | 355 | 1.0E-11 |
| sp|O45903|MECR1_CAEEL | Probable trans-2-enoyl-CoA reductase 1, mitochondrial OS=Caenorhabditis elegans GN=W09H1.5 PE=3 SV=1 | 40 | 226 | 1.0E-11 |
| sp|Q7TXK8|MSL7_MYCBO | Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 | 51 | 354 | 2.0E-11 |
| sp|P20368|ADH1_ZYMMO | Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 | 40 | 354 | 2.0E-11 |
| sp|P96285|PKS1_MYCTU | Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 | 51 | 354 | 2.0E-11 |
| sp|Q9Z9U1|DHSO_BACHD | Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 | 20 | 305 | 2.0E-11 |
| sp|Q5HRD6|ADH_STAEQ | Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 | 26 | 308 | 3.0E-11 |
| sp|P26646|ACUI_ECOLI | Probable acrylyl-CoA reductase AcuI OS=Escherichia coli (strain K12) GN=acuI PE=1 SV=1 | 17 | 277 | 3.0E-11 |
| sp|P0CH37|ADHC2_MYCS2 | NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 | 35 | 339 | 3.0E-11 |
| sp|P0CH36|ADHC1_MYCS2 | NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 | 35 | 339 | 3.0E-11 |
| sp|P25984|ADH_CLOBE | NADP-dependent isopropanol dehydrogenase OS=Clostridium beijerinckii GN=adh PE=1 SV=2 | 22 | 337 | 4.0E-11 |
| sp|Q5HE19|ZDH1_STAAC | Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 | 24 | 226 | 5.0E-11 |
| sp|Q8NVD1|ZDH1_STAAW | Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 | 24 | 226 | 5.0E-11 |
| sp|Q6G7C8|ZDH1_STAAS | Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 | 24 | 226 | 5.0E-11 |
| sp|Q8CQ56|ADH_STAES | Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 | 26 | 308 | 5.0E-11 |
| sp|Q6GEP3|ZDH1_STAAR | Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 | 24 | 226 | 5.0E-11 |
| sp|P77360|YPHC_ECOLI | Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 | 22 | 354 | 5.0E-11 |
| sp|Q3UNZ8|QORL2_MOUSE | Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 | 32 | 355 | 5.0E-11 |
| sp|Q9Z311|MECR_RAT | Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 | 26 | 226 | 5.0E-11 |
| sp|Q7YS70|MECR_BOVIN | Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 | 26 | 226 | 5.0E-11 |
| sp|Q67N85|TDH_SYMTH | L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 | 28 | 350 | 6.0E-11 |
| sp|B0BNC9|QORL2_RAT | Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 | 32 | 355 | 7.0E-11 |
| sp|P99173|ZDH1_STAAN | Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 | 24 | 226 | 7.0E-11 |
| sp|P63475|ZDH1_STAAM | Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 | 24 | 226 | 7.0E-11 |
| sp|H1ZV38|GEOA_CASDE | Geraniol dehydrogenase OS=Castellaniella defragrans GN=geoA PE=1 SV=1 | 40 | 352 | 1.0E-10 |
| sp|P14940|ADH_CUPNE | Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 | 26 | 355 | 1.0E-10 |
| sp|A6QQF5|QORL2_BOVIN | Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 | 40 | 355 | 1.0E-10 |
| sp|Q24K16|ZADH2_BOVIN | Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 | 3 | 277 | 1.0E-10 |
| sp|Q921W4|QORL1_MOUSE | Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 | 33 | 294 | 5.0E-10 |
| sp|Q9DCS3|MECR_MOUSE | Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 | 26 | 226 | 5.0E-10 |
| sp|P78870|FADH1_SCHPO | Probable S-(hydroxymethyl)glutathione dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.07c PE=2 SV=2 | 40 | 345 | 5.0E-10 |
| sp|C0SPA5|ADHA_BACSU | Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 | 60 | 339 | 1.0E-09 |
| sp|P25405|ADH1A_SAAHA | Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 | 40 | 274 | 2.0E-09 |
| sp|Q5HM44|ZDH1_STAEQ | Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 | 24 | 226 | 2.0E-09 |
| sp|P80512|ADH1_NAJNA | Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 | 40 | 254 | 2.0E-09 |
| sp|Q96XE0|ADH_SULTO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 | 26 | 349 | 2.0E-09 |
| sp|P54006|TOXD_COCCA | Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 | 30 | 226 | 2.0E-09 |
| sp|P19096|FAS_MOUSE | Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 | 42 | 355 | 3.0E-09 |
| sp|P9WQB9|ADHD_MYCTU | Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 | 26 | 353 | 4.0E-09 |
| sp|P9WQB8|ADHD_MYCTO | Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 | 26 | 353 | 4.0E-09 |
| sp|P86885|ADH1_MESAU | Alcohol dehydrogenase 1 OS=Mesocricetus auratus GN=ADH1 PE=1 SV=1 | 46 | 273 | 4.0E-09 |
| sp|Q8CRJ7|ZDH1_STAES | Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 | 24 | 226 | 5.0E-09 |
| sp|Q337Y2|CADH3_ORYSJ | Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 | 37 | 274 | 6.0E-09 |
| sp|P00326|ADH1G_HUMAN | Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2 | 40 | 273 | 7.0E-09 |
| sp|B2HIL7|MSL7_MYCMM | Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 | 51 | 226 | 7.0E-09 |
| sp|O74822|YBJB_SCHPO | Zinc-type alcohol dehydrogenase-like protein C337.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.11 PE=3 SV=1 | 20 | 208 | 8.0E-09 |
| sp|Q08350|CADH7_PICAB | Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 | 11 | 275 | 9.0E-09 |
| sp|P80175|ADHN_AMYME | NDMA-dependent alcohol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 | 38 | 347 | 1.0E-08 |
| sp|O82035|CADH2_PICAB | Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 | 11 | 275 | 1.0E-08 |
| sp|Q40976|CADH_PINRA | Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 | 11 | 275 | 2.0E-08 |
| sp|P12785|FAS_RAT | Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 | 42 | 355 | 2.0E-08 |
| sp|Q3MIE4|VAT1_RAT | Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 | 40 | 274 | 2.0E-08 |
| sp|Q9UYX0|TDH_PYRAB | Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 | 27 | 350 | 2.0E-08 |
| sp|O58389|TDH_PYRHO | Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 | 20 | 350 | 2.0E-08 |
| sp|Q9V6U9|MECR_DROME | Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Drosophila melanogaster GN=CG16935 PE=3 SV=2 | 26 | 226 | 2.0E-08 |
| sp|B2NI93|GEDH_CARLC | Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 | 26 | 339 | 3.0E-08 |
| sp|P80094|FADH_AMYME | S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 | 26 | 352 | 3.0E-08 |
| sp|P00325|ADH1B_HUMAN | Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B PE=1 SV=2 | 40 | 273 | 3.0E-08 |
| sp|Q55DM7|PKS2_DICDI | Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 | 26 | 352 | 3.0E-08 |
| sp|Q9ZRF1|MTDH_FRAAN | Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 | 37 | 222 | 5.0E-08 |
| sp|Q6V4H0|10HGO_CATRO | 8-hydroxygeraniol dehydrogenase OS=Catharanthus roseus GN=10HGO PE=1 SV=1 | 1 | 309 | 6.0E-08 |
| sp|P79896|ADHX_SPAAU | Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1 | 26 | 345 | 7.0E-08 |
| sp|P73138|FRMA_SYNY3 | S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 | 26 | 350 | 7.0E-08 |
| sp|Q8U259|TDH_PYRFU | Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 | 27 | 350 | 7.0E-08 |
| sp|P39451|ADHP_ECOLI | Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1 | 31 | 223 | 8.0E-08 |
| sp|Q5R1W2|ADH1B_PANTR | Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3 | 73 | 273 | 9.0E-08 |
| sp|P12276|FAS_CHICK | Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 | 1 | 355 | 9.0E-08 |
| sp|Q62465|VAT1_MOUSE | Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 | 40 | 274 | 1.0E-07 |
| sp|P9WQC5|ADHC_MYCTU | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 | 37 | 309 | 1.0E-07 |
| sp|P9WQC4|ADHC_MYCTO | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 | 37 | 309 | 1.0E-07 |
| sp|P0A4X1|ADHC_MYCBO | NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 | 37 | 309 | 1.0E-07 |
| sp|Q0J6T3|CADH5_ORYSJ | Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 | 37 | 219 | 1.0E-07 |
| sp|P80467|ADHX_SAAHA | Alcohol dehydrogenase class-3 OS=Saara hardwickii PE=1 SV=1 | 40 | 350 | 1.0E-07 |
| sp|P75691|YAHK_ECOLI | Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 | 71 | 344 | 1.0E-07 |
| sp|P31656|CADH_MEDSA | Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 | 37 | 309 | 1.0E-07 |
| sp|P49645|ADH1_APTAU | Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 | 40 | 273 | 2.0E-07 |
| sp|P14139|ADH1B_PAPHA | Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH1B PE=2 SV=2 | 73 | 273 | 2.0E-07 |
| sp|Q2MFP3|DOIAD_STRRY | 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 | 28 | 274 | 2.0E-07 |
| sp|Q4R639|DHSO_MACFA | Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 | 26 | 339 | 3.0E-07 |
| sp|Q17335|ADHX_CAEEL | Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1 | 58 | 276 | 3.0E-07 |
| sp|P49327|FAS_HUMAN | Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 | 42 | 354 | 3.0E-07 |
| sp|P00328|ADH1S_HORSE | Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3 | 40 | 245 | 3.0E-07 |
| sp|C5BB99|TDH_EDWI9 | L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 | 28 | 353 | 3.0E-07 |
| sp|Q80TB8|VAT1L_MOUSE | Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 | 22 | 184 | 4.0E-07 |
| sp|P19333|VAT1_TORCA | Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 | 34 | 242 | 4.0E-07 |
| sp|Q9HCJ6|VAT1L_HUMAN | Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 | 22 | 184 | 4.0E-07 |
| sp|B3PUI4|TDH_RHIE6 | L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 | 26 | 274 | 4.0E-07 |
| sp|P19631|ADH1_COTJA | Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1 | 40 | 273 | 4.0E-07 |
| sp|Q06004|DHSO_BACSU | Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 | 1 | 279 | 4.0E-07 |
| sp|P46415|ADHX_DROME | Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3 | 40 | 345 | 5.0E-07 |
| sp|O95825|QORL1_HUMAN | Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 | 20 | 294 | 5.0E-07 |
| sp|P14941|ADH_THEBR | NADP-dependent isopropanol dehydrogenase OS=Thermoanaerobacter brockii GN=adh PE=1 SV=1 | 69 | 320 | 5.0E-07 |
| sp|Q54YT4|MECR_DICDI | Trans-2-enoyl-CoA reductase, mitochondrial OS=Dictyostelium discoideum GN=mecr PE=3 SV=1 | 25 | 230 | 5.0E-07 |
| sp|P81601|ADHL_GADMO | Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1 | 40 | 345 | 5.0E-07 |
| sp|O06012|ADHB_BACSU | Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB OS=Bacillus subtilis (strain 168) GN=adhB PE=3 SV=2 | 22 | 283 | 5.0E-07 |
| sp|P23991|ADH1_CHICK | Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2 | 40 | 273 | 6.0E-07 |
| sp|Q1MDT5|TDH_RHIL3 | L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 | 32 | 274 | 6.0E-07 |
| sp|Q2K618|TDH_RHIEC | L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 | 32 | 274 | 6.0E-07 |
| sp|Q02912|DHSO_BOMMO | Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 | 22 | 222 | 6.0E-07 |
| sp|Q6WAU0|PULR_MENPI | (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 | 152 | 320 | 7.0E-07 |
| sp|Q4R0J7|ARD1_UROFA | D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 | 26 | 313 | 7.0E-07 |
| sp|P9WQE9|PHAS_MYCTU | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 | 37 | 257 | 8.0E-07 |
| sp|P9WQE8|PHAS_MYCTO | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 | 37 | 257 | 8.0E-07 |
| sp|A5U9F4|PHAS_MYCTA | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 | 37 | 257 | 8.0E-07 |
| sp|Q7TVK8|PHAS_MYCBO | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 | 37 | 257 | 8.0E-07 |
| sp|Q5LS56|ACUI_RUEPO | Acrylyl-CoA reductase AcuI OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=acuI PE=2 SV=1 | 26 | 226 | 9.0E-07 |
| sp|B9J738|TDH_AGRRK | L-threonine 3-dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tdh PE=3 SV=1 | 26 | 274 | 9.0E-07 |
| sp|P32771|FADH_YEAST | S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFA1 PE=1 SV=1 | 2 | 264 | 9.0E-07 |
| sp|A1KQG0|PHAS_MYCBP | Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 | 37 | 257 | 9.0E-07 |
| sp|P42754|MTDH_PETCR | Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 | 35 | 222 | 1.0E-06 |
| sp|P41680|ADH1_PERMA | Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2 | 71 | 273 | 1.0E-06 |
| sp|Q7XWU3|CADH6_ORYSJ | Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 | 7 | 273 | 1.0E-06 |
| sp|O64969|CADH_EUCGL | Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 | 10 | 309 | 1.0E-06 |
| sp|P39462|ADH_SULSO | NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 | 26 | 349 | 2.0E-06 |
| sp|Q869W9|PKS16_DICDI | Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 | 36 | 355 | 2.0E-06 |
| sp|P31655|CADH2_EUCGU | Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 | 10 | 309 | 2.0E-06 |
| sp|Q28GQ2|MECR_XENTR | Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 | 21 | 226 | 2.0E-06 |
| sp|A4FND4|TDH_SACEN | L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 | 26 | 353 | 2.0E-06 |
| sp|Q6DAT5|TDH_PECAS | L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 | 28 | 350 | 2.0E-06 |
| sp|P80222|ADH1_ALLMI | Alcohol dehydrogenase 1 OS=Alligator mississippiensis PE=1 SV=1 | 40 | 252 | 2.0E-06 |
| sp|O82515|MTDH_MEDSA | Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 | 37 | 226 | 3.0E-06 |
| sp|Q9XXC8|MECR2_CAEEL | Probable trans-2-enoyl-CoA reductase 2, mitochondrial OS=Caenorhabditis elegans GN=Y48A6B.9 PE=3 SV=1 | 7 | 308 | 3.0E-06 |
| sp|P41637|CADH_PINTA | Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 | 11 | 333 | 3.0E-06 |
| sp|O19053|ADHX_RABIT | Alcohol dehydrogenase class-3 OS=Oryctolagus cuniculus GN=ADH5 PE=2 SV=3 | 40 | 262 | 3.0E-06 |
| sp|Q38707|MTDH_APIGR | Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 | 1 | 222 | 4.0E-06 |
| sp|O07615|YHFP_BACSU | Putative quinone oxidoreductase YhfP OS=Bacillus subtilis (strain 168) GN=yhfP PE=1 SV=1 | 41 | 354 | 4.0E-06 |
| sp|P06757|ADH1_RAT | Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3 | 64 | 273 | 5.0E-06 |
| sp|Q39173|P2_ARATH | NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 | 152 | 354 | 7.0E-06 |
| sp|Q6GQN8|MECR_DANRE | Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 | 33 | 222 | 7.0E-06 |
| sp|P9WQC7|ADHB_MYCTU | Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 | 39 | 221 | 8.0E-06 |
| sp|P9WQC6|ADHB_MYCTO | Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 | 39 | 221 | 8.0E-06 |
| sp|Q7U1B9|ADHB_MYCBO | Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 | 39 | 221 | 8.0E-06 |
| sp|Q9C0Y6|YKM8_SCHPO | Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 | 172 | 354 | 9.0E-06 |
| sp|C6DIA7|TDH_PECCP | L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 | 28 | 352 | 9.0E-06 |
| sp|P80360|ADHX_MYXGL | Alcohol dehydrogenase class-3 OS=Myxine glutinosa PE=1 SV=1 | 26 | 277 | 1.0E-05 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.773 | 0.304 | 0.2036 | 0.095 | 0.2719 | 0.1156 | 0.0423 | 0.0602 | 0.0473 | 0.0192 |
| Orthofinder run ID | 4 |
| Orthogroup | 535 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|3383 MAQSIPQTVKQWTVTAQDGKDGFNALKLLEKPVPALGDSQVLVKLHAASLNYRDLIIPLGMYPFPTAPNVVPGSD GAGTVLAVGKHVTRFRPGDKVVTLFNQEHIGGPLTAAGLQSGLGGVLDGTLRSVGAFGEQGLVAMPESLSMPEAA TLTCAGLTAWNALYGLADHQVKAGDWVLTQGTGGVSIFALQFAKAAGARVVATTGSADKVAVLKKLGADHVLNYK ETPGWGAEAKKLTNGGVGFDHIVEVAGATSMAQSLEAIRLDGVITIIGFVGGNSSDQPGFLDCLNRQCIARGILV GSRAQMEDMCRAIEANPDRLRPVVDNKTFTLDQAKEAYEYQFSGKHFGKVCVEIQ* |
| Coding | >Hirsu2|3383 ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCTGCATGCTGCGTCTCTC AACTATCGCGACCTCATCATCCCCTTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGAC GGGGCCGGCACCGTCCTCGCCGTGGGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTC AACCAGGAGCACATCGGCGGGCCGCTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACG CTGCGCTCCGTCGGCGCCTTCGGCGAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCG ACGCTGACCTGCGCCGGGCTGACGGCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGAC TGGGTCCTGACGCAGGGCACCGGCGGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTC GTCGCCACCACGGGCTCGGCCGACAAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAG GAGACGCCCGGATGGGGCGCCGAGGCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTC GCGGGCGCGACGTCGATGGCGCAGAGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTC GGCGGCAACTCAAGCGACCAGCCGGGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTC GGCAGCCGGGCCCAGATGGAGGACATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGAC AACAAGACCTTCACGCTGGACCAGGCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTC TGCGTCGAGATTCAGTGA |
| Transcript | >Hirsu2|3383 ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCTGCATGCTGCGTCTCTC AACTATCGCGACCTCATCATCCCCTTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGAC GGGGCCGGCACCGTCCTCGCCGTGGGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTC AACCAGGAGCACATCGGCGGGCCGCTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACG CTGCGCTCCGTCGGCGCCTTCGGCGAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCG ACGCTGACCTGCGCCGGGCTGACGGCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGAC TGGGTCCTGACGCAGGGCACCGGCGGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTC GTCGCCACCACGGGCTCGGCCGACAAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAG GAGACGCCCGGATGGGGCGCCGAGGCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTC GCGGGCGCGACGTCGATGGCGCAGAGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTC GGCGGCAACTCAAGCGACCAGCCGGGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTC GGCAGCCGGGCCCAGATGGAGGACATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGAC AACAAGACCTTCACGCTGGACCAGGCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTC TGCGTCGAGATTCAGTGA |
| Gene | >Hirsu2|3383 ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCGTATGTGGCGTGCCTTT TCCCTCTTTCCCCCGCCCTGTCCGGGTTCTCTTCCGGCTTGGAAGCCAAGTTCTTTGCTCGTGAAGTCGAGTATT GTCGGACGTCAACCCACCTCGTTGCTCGTATCTCCAGCACGGCATATATGTATAATATGGAAGTCGGGAGAATGT GAACAAGCGTATCACTGACGTGTAATGCTCAGTGCATGCTGCGTCTCTCAACGTGAGCCTGCCGTGAGCGAGAAC GTCAACAGGTGCTTGTATACTGACAGAAGGGCATCCTCTCCGCCACGGGAAAAGTATCGCGACCTCATCATCCCC TTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGACGGGGCCGGCACCGTCCTCGCCGTG GGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTCAACCAGGAGCACATCGGCGGGCCG CTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACGCTGCGCTCCGTCGGCGCCTTCGGC GAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCGACGCTGACCTGCGCCGGGCTGACG GCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGACTGGGTCCTGACGCAGGGCACCGGC GGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTCGTCGCCACCACGGGCTCGGCCGAC AAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAGGAGACGCCCGGATGGGGCGCCGAG GCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTCGCGGGCGCGACGTCGATGGCGCAG AGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTCGGCGGCAACTCAAGCGACCAGCCG GGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTCGGCAGCCGGGCCCAGATGGAGGAC ATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGACAACAAGACCTTCACGCTGGACCAG GCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTCTGCGTCGAGATTCAGTGA |