Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3383
Gene name
LocationContig_188:13951..15295
Strand+
Gene length (bp)1344
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.2E-25 184 312
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.6E-14 216 351
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 7.4E-09 39 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 17 354 2.0E-94
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 13 308 1.0E-31
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 17 355 2.0E-26
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1 353 9.0E-26
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 24 355 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 17 354 2.0E-94
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 13 308 1.0E-31
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 17 355 2.0E-26
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1 353 9.0E-26
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 24 355 2.0E-24
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 4 353 1.0E-23
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 18 354 4.0E-23
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 26 355 2.0E-22
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 4 353 4.0E-22
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 14 350 5.0E-22
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 26 354 6.0E-22
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 22 353 7.0E-22
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 32 339 9.0E-22
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 5 271 2.0E-21
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 22 353 2.0E-21
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 33 339 6.0E-21
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 4 308 1.0E-20
sp|F2Z678|ADH2_YARLI Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 32 308 2.0E-20
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 1 308 2.0E-20
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 4 353 2.0E-20
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 4 340 3.0E-20
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 33 339 4.0E-20
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 33 339 7.0E-20
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 4 353 1.0E-19
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 32 353 1.0E-19
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 4 353 3.0E-19
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 4 353 3.0E-19
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 2 352 4.0E-19
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 33 339 4.0E-19
sp|P08843|ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 4 354 5.0E-19
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 33 339 5.0E-19
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 4 353 6.0E-19
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 4 353 7.0E-19
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 27 353 1.0E-18
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 33 339 6.0E-18
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 2 352 6.0E-18
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 4 354 1.0E-17
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 3 354 2.0E-17
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 4 352 2.0E-17
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 2 352 2.0E-17
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 4 352 4.0E-17
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 37 224 4.0E-17
sp|Q8NXU1|ADH_STAAW Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q6GBM4|ADH_STAAS Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q6GJ63|ADH_STAAR Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q5HI63|ADH_STAAC Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q2YSX0|ADH_STAAB Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q2G0G1|ADH_STAA8 Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q2FJ31|ADH_STAA3 Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 30 353 5.0E-17
sp|Q53865|CCR_STRCU Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 20 352 6.0E-17
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 30 353 8.0E-17
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 30 353 8.0E-17
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 1 345 9.0E-17
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 33 339 9.0E-17
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 2 308 2.0E-16
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 2 308 2.0E-16
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1 277 2.0E-16
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 4 353 3.0E-16
sp|P07754|ADH3_EMENI Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 32 354 4.0E-16
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 26 353 8.0E-16
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 29 350 8.0E-16
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 2 355 1.0E-15
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 19 242 1.0E-15
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 20 352 2.0E-15
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 1 314 3.0E-15
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 3 354 3.0E-15
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 4 355 4.0E-15
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 39 354 4.0E-15
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 22 305 9.0E-15
sp|A4YGN0|SUCD_METS5 Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 40 274 2.0E-14
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 40 354 3.0E-14
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 40 354 3.0E-14
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 39 354 8.0E-14
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 38 280 9.0E-14
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 40 274 1.0E-13
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 38 339 2.0E-13
sp|P00332|ADH_SCHPO Alcohol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh1 PE=1 SV=2 22 241 2.0E-13
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 39 354 2.0E-13
sp|Q3J6K9|ACUI_RHOS4 Acrylyl-CoA reductase AcuI OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=acuI PE=1 SV=1 14 277 6.0E-13
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 37 277 8.0E-13
sp|O42909|YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 20 226 9.0E-13
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 23 273 1.0E-12
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 26 226 4.0E-12
sp|P54202|ADH2_EMENI Alcohol dehydrogenase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcB PE=3 SV=2 6 354 5.0E-12
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 37 273 6.0E-12
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 24 352 7.0E-12
sp|Q0KDL6|ADH_CUPNH Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 26 355 1.0E-11
sp|O45903|MECR1_CAEEL Probable trans-2-enoyl-CoA reductase 1, mitochondrial OS=Caenorhabditis elegans GN=W09H1.5 PE=3 SV=1 40 226 1.0E-11
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 51 354 2.0E-11
sp|P20368|ADH1_ZYMMO Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 40 354 2.0E-11
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 51 354 2.0E-11
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 20 305 2.0E-11
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 26 308 3.0E-11
sp|P26646|ACUI_ECOLI Probable acrylyl-CoA reductase AcuI OS=Escherichia coli (strain K12) GN=acuI PE=1 SV=1 17 277 3.0E-11
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 35 339 3.0E-11
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 35 339 3.0E-11
sp|P25984|ADH_CLOBE NADP-dependent isopropanol dehydrogenase OS=Clostridium beijerinckii GN=adh PE=1 SV=2 22 337 4.0E-11
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 24 226 5.0E-11
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 24 226 5.0E-11
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 24 226 5.0E-11
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 26 308 5.0E-11
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 24 226 5.0E-11
sp|P77360|YPHC_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 22 354 5.0E-11
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 32 355 5.0E-11
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 26 226 5.0E-11
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 26 226 5.0E-11
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 28 350 6.0E-11
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 32 355 7.0E-11
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 24 226 7.0E-11
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 24 226 7.0E-11
sp|H1ZV38|GEOA_CASDE Geraniol dehydrogenase OS=Castellaniella defragrans GN=geoA PE=1 SV=1 40 352 1.0E-10
sp|P14940|ADH_CUPNE Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 26 355 1.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 40 355 1.0E-10
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 3 277 1.0E-10
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 33 294 5.0E-10
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 26 226 5.0E-10
sp|P78870|FADH1_SCHPO Probable S-(hydroxymethyl)glutathione dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.07c PE=2 SV=2 40 345 5.0E-10
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 60 339 1.0E-09
sp|P25405|ADH1A_SAAHA Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 40 274 2.0E-09
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 24 226 2.0E-09
sp|P80512|ADH1_NAJNA Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 40 254 2.0E-09
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 26 349 2.0E-09
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 30 226 2.0E-09
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 42 355 3.0E-09
sp|P9WQB9|ADHD_MYCTU Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 26 353 4.0E-09
sp|P9WQB8|ADHD_MYCTO Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 26 353 4.0E-09
sp|P86885|ADH1_MESAU Alcohol dehydrogenase 1 OS=Mesocricetus auratus GN=ADH1 PE=1 SV=1 46 273 4.0E-09
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 24 226 5.0E-09
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 37 274 6.0E-09
sp|P00326|ADH1G_HUMAN Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2 40 273 7.0E-09
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 51 226 7.0E-09
sp|O74822|YBJB_SCHPO Zinc-type alcohol dehydrogenase-like protein C337.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.11 PE=3 SV=1 20 208 8.0E-09
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 11 275 9.0E-09
sp|P80175|ADHN_AMYME NDMA-dependent alcohol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 38 347 1.0E-08
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 11 275 1.0E-08
sp|Q40976|CADH_PINRA Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 11 275 2.0E-08
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 42 355 2.0E-08
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 40 274 2.0E-08
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 27 350 2.0E-08
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 20 350 2.0E-08
sp|Q9V6U9|MECR_DROME Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Drosophila melanogaster GN=CG16935 PE=3 SV=2 26 226 2.0E-08
sp|B2NI93|GEDH_CARLC Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 26 339 3.0E-08
sp|P80094|FADH_AMYME S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 26 352 3.0E-08
sp|P00325|ADH1B_HUMAN Alcohol dehydrogenase 1B OS=Homo sapiens GN=ADH1B PE=1 SV=2 40 273 3.0E-08
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 26 352 3.0E-08
sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 37 222 5.0E-08
sp|Q6V4H0|10HGO_CATRO 8-hydroxygeraniol dehydrogenase OS=Catharanthus roseus GN=10HGO PE=1 SV=1 1 309 6.0E-08
sp|P79896|ADHX_SPAAU Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1 26 345 7.0E-08
sp|P73138|FRMA_SYNY3 S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 26 350 7.0E-08
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 27 350 7.0E-08
sp|P39451|ADHP_ECOLI Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1 31 223 8.0E-08
sp|Q5R1W2|ADH1B_PANTR Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3 73 273 9.0E-08
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 355 9.0E-08
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 40 274 1.0E-07
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 37 309 1.0E-07
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 37 309 1.0E-07
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 37 309 1.0E-07
sp|Q0J6T3|CADH5_ORYSJ Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 37 219 1.0E-07
sp|P80467|ADHX_SAAHA Alcohol dehydrogenase class-3 OS=Saara hardwickii PE=1 SV=1 40 350 1.0E-07
sp|P75691|YAHK_ECOLI Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 71 344 1.0E-07
sp|P31656|CADH_MEDSA Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 37 309 1.0E-07
sp|P49645|ADH1_APTAU Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 40 273 2.0E-07
sp|P14139|ADH1B_PAPHA Alcohol dehydrogenase 1B OS=Papio hamadryas GN=ADH1B PE=2 SV=2 73 273 2.0E-07
sp|Q2MFP3|DOIAD_STRRY 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 28 274 2.0E-07
sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 26 339 3.0E-07
sp|Q17335|ADHX_CAEEL Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1 58 276 3.0E-07
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 42 354 3.0E-07
sp|P00328|ADH1S_HORSE Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3 40 245 3.0E-07
sp|C5BB99|TDH_EDWI9 L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 28 353 3.0E-07
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 22 184 4.0E-07
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 34 242 4.0E-07
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 22 184 4.0E-07
sp|B3PUI4|TDH_RHIE6 L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 26 274 4.0E-07
sp|P19631|ADH1_COTJA Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1 40 273 4.0E-07
sp|Q06004|DHSO_BACSU Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 1 279 4.0E-07
sp|P46415|ADHX_DROME Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3 40 345 5.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 20 294 5.0E-07
sp|P14941|ADH_THEBR NADP-dependent isopropanol dehydrogenase OS=Thermoanaerobacter brockii GN=adh PE=1 SV=1 69 320 5.0E-07
sp|Q54YT4|MECR_DICDI Trans-2-enoyl-CoA reductase, mitochondrial OS=Dictyostelium discoideum GN=mecr PE=3 SV=1 25 230 5.0E-07
sp|P81601|ADHL_GADMO Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1 40 345 5.0E-07
sp|O06012|ADHB_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB OS=Bacillus subtilis (strain 168) GN=adhB PE=3 SV=2 22 283 5.0E-07
sp|P23991|ADH1_CHICK Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2 40 273 6.0E-07
sp|Q1MDT5|TDH_RHIL3 L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 32 274 6.0E-07
sp|Q2K618|TDH_RHIEC L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 32 274 6.0E-07
sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 22 222 6.0E-07
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 152 320 7.0E-07
sp|Q4R0J7|ARD1_UROFA D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 26 313 7.0E-07
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 37 257 8.0E-07
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 37 257 8.0E-07
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 37 257 8.0E-07
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 37 257 8.0E-07
sp|Q5LS56|ACUI_RUEPO Acrylyl-CoA reductase AcuI OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=acuI PE=2 SV=1 26 226 9.0E-07
sp|B9J738|TDH_AGRRK L-threonine 3-dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tdh PE=3 SV=1 26 274 9.0E-07
sp|P32771|FADH_YEAST S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFA1 PE=1 SV=1 2 264 9.0E-07
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 37 257 9.0E-07
sp|P42754|MTDH_PETCR Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 35 222 1.0E-06
sp|P41680|ADH1_PERMA Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2 71 273 1.0E-06
sp|Q7XWU3|CADH6_ORYSJ Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 7 273 1.0E-06
sp|O64969|CADH_EUCGL Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 10 309 1.0E-06
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 26 349 2.0E-06
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 36 355 2.0E-06
sp|P31655|CADH2_EUCGU Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 10 309 2.0E-06
sp|Q28GQ2|MECR_XENTR Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 21 226 2.0E-06
sp|A4FND4|TDH_SACEN L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 26 353 2.0E-06
sp|Q6DAT5|TDH_PECAS L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 28 350 2.0E-06
sp|P80222|ADH1_ALLMI Alcohol dehydrogenase 1 OS=Alligator mississippiensis PE=1 SV=1 40 252 2.0E-06
sp|O82515|MTDH_MEDSA Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 37 226 3.0E-06
sp|Q9XXC8|MECR2_CAEEL Probable trans-2-enoyl-CoA reductase 2, mitochondrial OS=Caenorhabditis elegans GN=Y48A6B.9 PE=3 SV=1 7 308 3.0E-06
sp|P41637|CADH_PINTA Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 11 333 3.0E-06
sp|O19053|ADHX_RABIT Alcohol dehydrogenase class-3 OS=Oryctolagus cuniculus GN=ADH5 PE=2 SV=3 40 262 3.0E-06
sp|Q38707|MTDH_APIGR Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 1 222 4.0E-06
sp|O07615|YHFP_BACSU Putative quinone oxidoreductase YhfP OS=Bacillus subtilis (strain 168) GN=yhfP PE=1 SV=1 41 354 4.0E-06
sp|P06757|ADH1_RAT Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3 64 273 5.0E-06
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 152 354 7.0E-06
sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 33 222 7.0E-06
sp|P9WQC7|ADHB_MYCTU Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 39 221 8.0E-06
sp|P9WQC6|ADHB_MYCTO Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 39 221 8.0E-06
sp|Q7U1B9|ADHB_MYCBO Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 39 221 8.0E-06
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 172 354 9.0E-06
sp|C6DIA7|TDH_PECCP L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 28 352 9.0E-06
sp|P80360|ADHX_MYXGL Alcohol dehydrogenase class-3 OS=Myxine glutinosa PE=1 SV=1 26 277 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3383
MAQSIPQTVKQWTVTAQDGKDGFNALKLLEKPVPALGDSQVLVKLHAASLNYRDLIIPLGMYPFPTAPNVVPGSD
GAGTVLAVGKHVTRFRPGDKVVTLFNQEHIGGPLTAAGLQSGLGGVLDGTLRSVGAFGEQGLVAMPESLSMPEAA
TLTCAGLTAWNALYGLADHQVKAGDWVLTQGTGGVSIFALQFAKAAGARVVATTGSADKVAVLKKLGADHVLNYK
ETPGWGAEAKKLTNGGVGFDHIVEVAGATSMAQSLEAIRLDGVITIIGFVGGNSSDQPGFLDCLNRQCIARGILV
GSRAQMEDMCRAIEANPDRLRPVVDNKTFTLDQAKEAYEYQFSGKHFGKVCVEIQ*
Coding >Hirsu2|3383
ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG
CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCTGCATGCTGCGTCTCTC
AACTATCGCGACCTCATCATCCCCTTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGAC
GGGGCCGGCACCGTCCTCGCCGTGGGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTC
AACCAGGAGCACATCGGCGGGCCGCTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACG
CTGCGCTCCGTCGGCGCCTTCGGCGAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCG
ACGCTGACCTGCGCCGGGCTGACGGCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGAC
TGGGTCCTGACGCAGGGCACCGGCGGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTC
GTCGCCACCACGGGCTCGGCCGACAAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAG
GAGACGCCCGGATGGGGCGCCGAGGCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTC
GCGGGCGCGACGTCGATGGCGCAGAGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTC
GGCGGCAACTCAAGCGACCAGCCGGGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTC
GGCAGCCGGGCCCAGATGGAGGACATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGAC
AACAAGACCTTCACGCTGGACCAGGCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTC
TGCGTCGAGATTCAGTGA
Transcript >Hirsu2|3383
ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG
CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCTGCATGCTGCGTCTCTC
AACTATCGCGACCTCATCATCCCCTTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGAC
GGGGCCGGCACCGTCCTCGCCGTGGGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTC
AACCAGGAGCACATCGGCGGGCCGCTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACG
CTGCGCTCCGTCGGCGCCTTCGGCGAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCG
ACGCTGACCTGCGCCGGGCTGACGGCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGAC
TGGGTCCTGACGCAGGGCACCGGCGGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTC
GTCGCCACCACGGGCTCGGCCGACAAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAG
GAGACGCCCGGATGGGGCGCCGAGGCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTC
GCGGGCGCGACGTCGATGGCGCAGAGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTC
GGCGGCAACTCAAGCGACCAGCCGGGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTC
GGCAGCCGGGCCCAGATGGAGGACATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGAC
AACAAGACCTTCACGCTGGACCAGGCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTC
TGCGTCGAGATTCAGTGA
Gene >Hirsu2|3383
ATGGCCCAGAGCATTCCCCAAACGGTGAAGCAGTGGACCGTCACGGCCCAGGACGGCAAAGATGGCTTCAATGCG
CTCAAGCTGTTGGAGAAGCCTGTTCCTGCCCTTGGCGACAGCCAAGTCCTGGTAAAGCGTATGTGGCGTGCCTTT
TCCCTCTTTCCCCCGCCCTGTCCGGGTTCTCTTCCGGCTTGGAAGCCAAGTTCTTTGCTCGTGAAGTCGAGTATT
GTCGGACGTCAACCCACCTCGTTGCTCGTATCTCCAGCACGGCATATATGTATAATATGGAAGTCGGGAGAATGT
GAACAAGCGTATCACTGACGTGTAATGCTCAGTGCATGCTGCGTCTCTCAACGTGAGCCTGCCGTGAGCGAGAAC
GTCAACAGGTGCTTGTATACTGACAGAAGGGCATCCTCTCCGCCACGGGAAAAGTATCGCGACCTCATCATCCCC
TTGGGCATGTACCCCTTCCCGACGGCCCCCAACGTCGTGCCCGGCTCGGACGGGGCCGGCACCGTCCTCGCCGTG
GGCAAGCACGTCACCCGGTTCCGGCCCGGCGATAAGGTCGTCACGCTCTTCAACCAGGAGCACATCGGCGGGCCG
CTGACGGCGGCGGGGCTCCAGTCGGGCCTGGGCGGCGTGCTGGACGGCACGCTGCGCTCCGTCGGCGCCTTCGGC
GAGCAGGGCCTAGTGGCCATGCCCGAGAGTCTGTCGATGCCGGAGGCGGCGACGCTGACCTGCGCCGGGCTGACG
GCCTGGAACGCGCTCTATGGCCTGGCCGACCACCAGGTCAAGGCGGGCGACTGGGTCCTGACGCAGGGCACCGGC
GGCGTGAGCATCTTCGCGCTGCAGTTCGCCAAGGCGGCGGGTGCGCGCGTCGTCGCCACCACGGGCTCGGCCGAC
AAGGTCGCCGTGCTGAAGAAGCTGGGCGCCGACCACGTGCTGAACTATAAGGAGACGCCCGGATGGGGCGCCGAG
GCCAAGAAGCTGACCAACGGCGGCGTCGGCTTCGACCACATCGTCGAGGTCGCGGGCGCGACGTCGATGGCGCAG
AGCCTCGAGGCGATCCGGCTTGACGGCGTCATCACCATCATCGGCTTCGTCGGCGGCAACTCAAGCGACCAGCCG
GGCTTCCTCGACTGCCTGAACCGGCAATGTATCGCGCGCGGCATCCTGGTCGGCAGCCGGGCCCAGATGGAGGAC
ATGTGCCGCGCCATCGAGGCGAACCCGGACCGGCTGCGGCCGGTCGTCGACAACAAGACCTTCACGCTGGACCAG
GCCAAGGAGGCGTACGAGTACCAGTTCTCCGGCAAGCACTTCGGCAAGGTCTGCGTCGAGATTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail