Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3368
Gene name
LocationContig_1872:2836..3340
Strand+
Gene length (bp)504
Transcript length (bp)504
Coding sequence length (bp)504
Protein length (aa) 168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3639 0.1494 0.9107 0.2198 0.1492 0.1144 0.0583 0.1934 0.2665 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4850
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00776
Ophiocordyceps camponoti-floridani Ophcf2|02389
Ophiocordyceps camponoti-rufipedis Ophun1|835
Ophiocordyceps kimflemingae Ophio5|3901
Ophiocordyceps subramaniannii Hirsu2|10916
Ophiocordyceps subramaniannii Hirsu2|3368 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3368
MCGQAPPGFVRLDMAVDIEDLDSSPECDDETFKSAGCTAEMEKGAKCAGQQTEGAQRCCAGKVQVRNLEGDCVEA
GNPWTKVGPLQIFLRKRQCDGCEVAGPYGPCCQDSDEWRNPDDGKCSKGKQGVPSEADLRMKRMIDGCEGLNAMA
SAMVHENITENTRIFAS*
Coding >Hirsu2|3368
ATGTGCGGGCAAGCTCCCCCCGGATTTGTCAGGTTGGACATGGCCGTCGACATCGAGGACCTGGACAGCTCGCCG
GAGTGCGATGACGAGACTTTCAAGTCGGCAGGCTGCACTGCCGAAATGGAAAAGGGGGCAAAATGTGCCGGGCAG
CAAACCGAAGGTGCGCAGCGCTGCTGCGCCGGCAAAGTCCAGGTCCGGAACCTCGAGGGGGACTGCGTCGAGGCC
GGGAACCCTTGGACGAAAGTAGGTCCGCTGCAGATCTTCCTTAGGAAGCGACAGTGCGACGGCTGCGAGGTGGCC
GGGCCGTACGGTCCCTGCTGCCAGGATTCGGACGAGTGGCGCAACCCCGACGACGGCAAATGCTCCAAGGGGAAG
CAGGGCGTCCCATCAGAAGCGGACTTGCGCATGAAGCGGATGATAGACGGTTGCGAGGGATTAAACGCCATGGCT
TCCGCGATGGTTCACGAAAATATTACCGAGAATACCCGCATCTTCGCGTCCTAA
Transcript >Hirsu2|3368
ATGTGCGGGCAAGCTCCCCCCGGATTTGTCAGGTTGGACATGGCCGTCGACATCGAGGACCTGGACAGCTCGCCG
GAGTGCGATGACGAGACTTTCAAGTCGGCAGGCTGCACTGCCGAAATGGAAAAGGGGGCAAAATGTGCCGGGCAG
CAAACCGAAGGTGCGCAGCGCTGCTGCGCCGGCAAAGTCCAGGTCCGGAACCTCGAGGGGGACTGCGTCGAGGCC
GGGAACCCTTGGACGAAAGTAGGTCCGCTGCAGATCTTCCTTAGGAAGCGACAGTGCGACGGCTGCGAGGTGGCC
GGGCCGTACGGTCCCTGCTGCCAGGATTCGGACGAGTGGCGCAACCCCGACGACGGCAAATGCTCCAAGGGGAAG
CAGGGCGTCCCATCAGAAGCGGACTTGCGCATGAAGCGGATGATAGACGGTTGCGAGGGATTAAACGCCATGGCT
TCCGCGATGGTTCACGAAAATATTACCGAGAATACCCGCATCTTCGCGTCCTAA
Gene >Hirsu2|3368
ATGTGCGGGCAAGCTCCCCCCGGATTTGTCAGGTTGGACATGGCCGTCGACATCGAGGACCTGGACAGCTCGCCG
GAGTGCGATGACGAGACTTTCAAGTCGGCAGGCTGCACTGCCGAAATGGAAAAGGGGGCAAAATGTGCCGGGCAG
CAAACCGAAGGTGCGCAGCGCTGCTGCGCCGGCAAAGTCCAGGTCCGGAACCTCGAGGGGGACTGCGTCGAGGCC
GGGAACCCTTGGACGAAAGTAGGTCCGCTGCAGATCTTCCTTAGGAAGCGACAGTGCGACGGCTGCGAGGTGGCC
GGGCCGTACGGTCCCTGCTGCCAGGATTCGGACGAGTGGCGCAACCCCGACGACGGCAAATGCTCCAAGGGGAAG
CAGGGCGTCCCATCAGAAGCGGACTTGCGCATGAAGCGGATGATAGACGGTTGCGAGGGATTAAACGCCATGGCT
TCCGCGATGGTTCACGAAAATATTACCGAGAATACCCGCATCTTCGCGTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail