Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3365
Gene name
LocationContig_1870:43..2525
Strand-
Gene length (bp)2482
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02200 STE STE like transcription factor 5.0E-56 48 156
PF00096 zf-C2H2 Zinc finger, C2H2 type 9.6E-04 549 573
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.1E-05 579 601
PF13894 zf-C2H2_4 C2H2-type zinc finger 3.7E-04 579 601

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 3 647 0.0E+00
sp|P43079|CPH1_CANAL Transcription factor CPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH1 PE=1 SV=3 26 197 1.0E-71
sp|P13574|STE12_YEAST Protein STE12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE12 PE=1 SV=1 14 195 2.0E-70
sp|Q08400|STE12_KLULA Protein STE12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE12 PE=3 SV=2 20 196 2.0E-70
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 556 629 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 3 647 0.0E+00
sp|P43079|CPH1_CANAL Transcription factor CPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH1 PE=1 SV=3 26 197 1.0E-71
sp|P13574|STE12_YEAST Protein STE12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE12 PE=1 SV=1 14 195 2.0E-70
sp|Q08400|STE12_KLULA Protein STE12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE12 PE=3 SV=2 20 196 2.0E-70
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 556 629 6.0E-13
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 556 629 6.0E-13
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 551 618 9.0E-13
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 551 618 9.0E-13
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 543 604 1.0E-12
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 453 604 1.0E-12
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 543 604 1.0E-12
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 547 604 2.0E-12
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 534 603 2.0E-12
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 543 604 3.0E-12
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 528 602 3.0E-12
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 547 604 3.0E-12
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 543 604 4.0E-12
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 547 604 4.0E-12
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 549 604 4.0E-12
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 556 605 5.0E-12
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 524 603 5.0E-12
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 549 604 5.0E-12
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 547 602 5.0E-12
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 529 610 5.0E-12
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 483 602 5.0E-12
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 529 602 6.0E-12
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 555 624 8.0E-12
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 531 604 8.0E-12
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 542 634 9.0E-12
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 527 602 9.0E-12
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 551 607 1.0E-11
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 551 618 1.0E-11
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 485 602 1.0E-11
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 549 604 1.0E-11
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 549 602 1.0E-11
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 542 602 1.0E-11
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 529 609 1.0E-11
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 551 602 1.0E-11
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 531 604 1.0E-11
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 547 604 1.0E-11
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 551 606 1.0E-11
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 549 604 1.0E-11
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 549 604 1.0E-11
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 549 604 1.0E-11
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 551 607 2.0E-11
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 551 607 2.0E-11
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 549 604 2.0E-11
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 529 610 2.0E-11
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 529 610 2.0E-11
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 549 604 2.0E-11
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 531 604 2.0E-11
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 549 604 2.0E-11
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 549 604 2.0E-11
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 555 622 2.0E-11
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 543 602 2.0E-11
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 543 602 3.0E-11
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 545 604 3.0E-11
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 543 602 3.0E-11
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 543 602 3.0E-11
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 551 601 3.0E-11
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 549 604 3.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 545 604 4.0E-11
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 531 604 4.0E-11
sp|Q6FJQ9|ACE2_CANGA Cell wall transcription factor ACE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACE2 PE=3 SV=1 545 603 4.0E-11
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 554 604 4.0E-11
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 545 619 4.0E-11
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 547 604 5.0E-11
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 554 600 5.0E-11
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 547 602 5.0E-11
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 545 604 5.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 545 604 5.0E-11
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 547 602 6.0E-11
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 547 602 6.0E-11
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 545 604 6.0E-11
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 543 602 6.0E-11
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 489 621 6.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 552 604 7.0E-11
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 489 604 7.0E-11
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 466 604 8.0E-11
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 545 604 9.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 538 604 9.0E-11
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 547 604 1.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 538 604 1.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 538 604 1.0E-10
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 547 601 1.0E-10
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 543 602 1.0E-10
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 489 621 1.0E-10
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 510 603 1.0E-10
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 547 604 1.0E-10
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 547 604 1.0E-10
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 547 604 1.0E-10
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 547 604 1.0E-10
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 547 604 1.0E-10
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 547 604 1.0E-10
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 547 604 1.0E-10
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 556 653 2.0E-10
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 547 604 2.0E-10
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 547 604 2.0E-10
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 547 604 2.0E-10
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 547 604 2.0E-10
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 547 604 2.0E-10
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 547 604 2.0E-10
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 547 604 2.0E-10
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 547 604 2.0E-10
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 547 604 2.0E-10
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 556 604 3.0E-10
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 547 604 3.0E-10
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 547 604 3.0E-10
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 547 602 3.0E-10
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 551 602 3.0E-10
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 556 601 4.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 543 604 4.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 543 604 4.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 543 604 4.0E-10
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 547 602 4.0E-10
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 510 603 4.0E-10
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 547 602 4.0E-10
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 553 606 5.0E-10
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 510 603 5.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 496 604 5.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 512 604 5.0E-10
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 547 604 5.0E-10
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 547 601 6.0E-10
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 547 604 6.0E-10
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 556 605 6.0E-10
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 547 604 6.0E-10
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 547 611 7.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 538 604 7.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 552 604 8.0E-10
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 556 604 8.0E-10
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 539 610 9.0E-10
sp|Q96JP5|ZFP91_HUMAN E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens GN=ZFP91 PE=1 SV=1 547 604 9.0E-10
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 556 604 9.0E-10
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 547 601 1.0E-09
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 556 602 1.0E-09
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 556 605 1.0E-09
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 510 615 1.0E-09
sp|Q62511|ZFP91_MOUSE E3 ubiquitin-protein ligase ZFP91 OS=Mus musculus GN=Zfp91 PE=1 SV=3 547 604 1.0E-09
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 545 604 1.0E-09
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 521 604 1.0E-09
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 551 601 2.0E-09
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 551 602 2.0E-09
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 551 602 2.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 556 604 2.0E-09
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 521 604 2.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 446 604 2.0E-09
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 521 604 2.0E-09
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 547 604 2.0E-09
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 547 604 2.0E-09
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 547 604 2.0E-09
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 547 604 2.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 510 602 2.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 556 649 2.0E-09
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 547 604 2.0E-09
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 528 601 2.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 556 604 2.0E-09
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 556 600 2.0E-09
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 547 604 2.0E-09
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 547 601 2.0E-09
sp|A0JNJ4|ZN692_BOVIN Zinc finger protein 692 OS=Bos taurus GN=ZNF692 PE=2 SV=1 547 604 2.0E-09
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 551 603 2.0E-09
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 548 602 2.0E-09
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 556 604 2.0E-09
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 556 604 2.0E-09
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 545 604 2.0E-09
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 551 601 3.0E-09
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 551 601 3.0E-09
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 551 601 3.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 553 604 3.0E-09
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 556 631 3.0E-09
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 545 601 3.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 556 602 3.0E-09
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 554 604 3.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 535 604 3.0E-09
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 547 604 3.0E-09
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 510 604 3.0E-09
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 549 609 3.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 547 602 4.0E-09
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 554 604 4.0E-09
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 556 654 4.0E-09
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 547 604 4.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 535 604 4.0E-09
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 554 604 4.0E-09
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 503 604 4.0E-09
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 556 604 4.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 546 628 4.0E-09
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 554 604 4.0E-09
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 551 601 5.0E-09
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 551 601 5.0E-09
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 553 604 5.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 535 604 5.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 535 604 5.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 535 604 5.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 547 602 5.0E-09
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 547 604 5.0E-09
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 503 604 5.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 516 602 5.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 556 608 5.0E-09
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 532 601 5.0E-09
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 545 603 5.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 533 602 6.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 556 605 6.0E-09
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 510 604 6.0E-09
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 547 601 6.0E-09
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 554 605 6.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 547 601 6.0E-09
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 547 666 6.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 556 605 7.0E-09
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 547 602 7.0E-09
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 547 601 7.0E-09
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 545 604 7.0E-09
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 510 604 7.0E-09
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 556 644 7.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 552 604 7.0E-09
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 551 601 8.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 8.0E-09
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 547 604 8.0E-09
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 537 604 8.0E-09
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 556 631 8.0E-09
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 553 604 8.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 440 602 8.0E-09
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 556 604 8.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 491 604 9.0E-09
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 551 619 9.0E-09
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 547 602 9.0E-09
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 556 601 9.0E-09
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 546 623 1.0E-08
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 546 623 1.0E-08
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 510 602 1.0E-08
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 510 602 1.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 556 655 1.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 517 609 1.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 517 609 1.0E-08
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 547 601 1.0E-08
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 547 601 1.0E-08
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 491 604 1.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 510 602 1.0E-08
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 547 604 1.0E-08
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 556 604 1.0E-08
sp|Q3U381|ZN692_MOUSE Zinc finger protein 692 OS=Mus musculus GN=Znf692 PE=2 SV=1 547 604 1.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 556 601 1.0E-08
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 547 630 1.0E-08
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 545 602 1.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 510 602 1.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 556 604 1.0E-08
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 556 604 1.0E-08
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 547 602 1.0E-08
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 510 604 1.0E-08
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 551 605 1.0E-08
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 556 604 1.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 556 604 1.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 556 606 1.0E-08
sp|Q9BU19|ZN692_HUMAN Zinc finger protein 692 OS=Homo sapiens GN=ZNF692 PE=1 SV=1 547 604 1.0E-08
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 556 604 1.0E-08
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 547 604 1.0E-08
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 546 623 2.0E-08
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 510 602 2.0E-08
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 477 601 2.0E-08
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 510 602 2.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 517 604 2.0E-08
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 477 601 2.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 535 604 2.0E-08
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 495 604 2.0E-08
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 547 604 2.0E-08
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 549 602 2.0E-08
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 554 599 2.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 555 604 2.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 537 604 2.0E-08
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 541 602 2.0E-08
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 550 601 2.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 556 604 2.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 556 604 2.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 534 601 2.0E-08
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 547 602 2.0E-08
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 553 601 2.0E-08
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 510 605 2.0E-08
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 510 605 2.0E-08
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 510 605 2.0E-08
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 510 605 2.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 534 601 2.0E-08
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 547 601 2.0E-08
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 551 602 2.0E-08
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 549 602 2.0E-08
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 556 604 2.0E-08
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 510 604 2.0E-08
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 532 604 2.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 534 601 2.0E-08
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 551 602 2.0E-08
sp|Q10938|YWS2_CAEEL Putative zinc finger protein B0310.2 OS=Caenorhabditis elegans GN=B0310.2 PE=3 SV=1 556 602 2.0E-08
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 551 602 2.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 2.0E-08
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 478 604 2.0E-08
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 556 610 2.0E-08
sp|O77027|CI_DROYA Protein cubitus interruptus (Fragment) OS=Drosophila yakuba GN=ci PE=3 SV=1 556 604 2.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 529 604 2.0E-08
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 551 602 2.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 547 604 2.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 547 604 2.0E-08
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 555 597 2.0E-08
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 510 604 2.0E-08
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 556 610 2.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 556 623 3.0E-08
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 546 623 3.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 555 603 3.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 555 603 3.0E-08
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 556 610 3.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 547 604 3.0E-08
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 507 604 3.0E-08
sp|Q8K083|ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus GN=Znf536 PE=2 SV=1 553 604 3.0E-08
sp|O15090|ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens GN=ZNF536 PE=1 SV=3 553 604 3.0E-08
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 545 666 3.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 510 604 3.0E-08
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 537 601 3.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 552 604 3.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 507 604 3.0E-08
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 547 605 3.0E-08
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 547 635 3.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 556 604 3.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 556 604 3.0E-08
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 553 605 3.0E-08
sp|A1Z9R4|ZN423_DROME Zinc finger protein 423 homolog OS=Drosophila melanogaster GN=Oaz PE=2 SV=2 556 659 3.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 537 604 3.0E-08
sp|O43830|ZNF73_HUMAN Zinc finger protein 73 OS=Homo sapiens GN=ZNF73 PE=3 SV=1 516 605 3.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 556 604 3.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 556 604 3.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 547 602 3.0E-08
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 556 604 3.0E-08
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 547 604 3.0E-08
sp|Q9JKY3|ZBT18_RAT Zinc finger and BTB domain-containing protein 18 OS=Rattus norvegicus GN=Zbtb18 PE=1 SV=1 553 604 3.0E-08
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 547 600 3.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 556 604 3.0E-08
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 537 601 3.0E-08
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 547 601 4.0E-08
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 556 603 4.0E-08
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 550 614 4.0E-08
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 510 654 4.0E-08
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 510 654 4.0E-08
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 510 654 4.0E-08
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 510 654 4.0E-08
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 510 654 4.0E-08
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 510 654 4.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 556 604 4.0E-08
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 510 604 4.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 459 601 4.0E-08
sp|Q9WUK6|ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus GN=Zbtb18 PE=1 SV=1 553 604 4.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 556 604 4.0E-08
sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus GN=ZBTB18 PE=2 SV=2 553 604 4.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 547 602 4.0E-08
sp|Q9NZV7|ZIM2_HUMAN Zinc finger imprinted 2 OS=Homo sapiens GN=ZIM2 PE=2 SV=1 550 609 4.0E-08
sp|Q99592|ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens GN=ZBTB18 PE=1 SV=1 553 604 4.0E-08
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 556 640 4.0E-08
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 556 604 4.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 4.0E-08
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 556 640 4.0E-08
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 550 614 4.0E-08
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 556 610 4.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 547 604 4.0E-08
sp|Q16670|ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens GN=ZSCAN26 PE=1 SV=2 509 605 4.0E-08
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 547 602 4.0E-08
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 547 602 4.0E-08
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 547 604 4.0E-08
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 553 604 4.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 556 610 4.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 529 604 4.0E-08
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 552 601 4.0E-08
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 537 604 4.0E-08
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 548 602 4.0E-08
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 521 604 4.0E-08
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 534 609 4.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 556 609 5.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 546 604 5.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 546 604 5.0E-08
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 556 648 5.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 550 601 5.0E-08
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 550 601 5.0E-08
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 550 601 5.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 547 601 5.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 556 604 5.0E-08
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 547 601 5.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 556 604 5.0E-08
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 556 603 5.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 550 601 5.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 538 604 5.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 547 604 5.0E-08
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 556 604 5.0E-08
sp|Q8BI66|ZN526_MOUSE Zinc finger protein 526 OS=Mus musculus GN=Znf526 PE=2 SV=1 542 602 5.0E-08
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 553 604 5.0E-08
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 510 607 5.0E-08
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 547 602 5.0E-08
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 556 601 5.0E-08
sp|Q801P1|ZBT18_XENLA Zinc finger and BTB domain-containing protein 18 OS=Xenopus laevis GN=zbtb18 PE=2 SV=2 553 604 5.0E-08
sp|Q1L8W0|ZBT18_DANRE Zinc finger and BTB domain-containing protein 18 OS=Danio rerio GN=zbtb18 PE=2 SV=1 550 604 5.0E-08
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 556 604 5.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 546 604 6.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 547 601 6.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 534 604 6.0E-08
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 553 604 6.0E-08
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 549 604 6.0E-08
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 521 604 6.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 547 604 6.0E-08
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 529 604 6.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 521 604 6.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 556 604 6.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 556 604 6.0E-08
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 556 621 6.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 533 604 6.0E-08
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 532 605 6.0E-08
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 548 602 6.0E-08
sp|A6QR00|ZN526_BOVIN Zinc finger protein 526 OS=Bos taurus GN=ZNF526 PE=2 SV=1 542 602 6.0E-08
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 549 655 6.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 547 602 6.0E-08
sp|Q8TF50|ZN526_HUMAN Zinc finger protein 526 OS=Homo sapiens GN=ZNF526 PE=2 SV=2 542 602 6.0E-08
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 553 604 6.0E-08
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 510 615 6.0E-08
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 553 604 6.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 7.0E-08
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 556 604 7.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 553 604 7.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 547 604 7.0E-08
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 484 611 7.0E-08
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 484 611 7.0E-08
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 553 604 7.0E-08
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 547 602 7.0E-08
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 545 604 7.0E-08
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 556 632 7.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 556 604 7.0E-08
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 556 604 7.0E-08
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 556 601 7.0E-08
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 556 604 7.0E-08
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 548 602 7.0E-08
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 547 604 7.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 556 604 7.0E-08
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 553 604 7.0E-08
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 556 602 7.0E-08
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 556 601 8.0E-08
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 556 606 8.0E-08
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 510 602 8.0E-08
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 545 604 8.0E-08
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 545 604 8.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 556 605 8.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 604 8.0E-08
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 556 604 8.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 556 601 8.0E-08
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 484 611 8.0E-08
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 547 604 8.0E-08
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 521 604 8.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 556 605 8.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 548 614 8.0E-08
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 556 604 8.0E-08
sp|Q9P2Y4|ZN219_HUMAN Zinc finger protein 219 OS=Homo sapiens GN=ZNF219 PE=1 SV=2 553 605 8.0E-08
sp|P51502|ZNF80_CHLAE Zinc finger protein 80 OS=Chlorocebus aethiops GN=ZNF80 PE=3 SV=1 551 604 8.0E-08
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 551 601 8.0E-08
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 556 601 9.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 553 604 9.0E-08
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 547 601 9.0E-08
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 556 632 9.0E-08
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 484 611 9.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 9.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 552 604 9.0E-08
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 547 604 9.0E-08
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 556 604 9.0E-08
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 556 601 9.0E-08
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 509 601 9.0E-08
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 556 601 9.0E-08
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 556 601 9.0E-08
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 556 602 9.0E-08
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 556 604 9.0E-08
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 537 604 9.0E-08
sp|B4DX44|ZN736_HUMAN Zinc finger protein 736 OS=Homo sapiens GN=ZNF736 PE=2 SV=2 556 604 9.0E-08
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 510 602 1.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 551 604 1.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 556 604 1.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 510 603 1.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 551 604 1.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 553 604 1.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 538 604 1.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 553 604 1.0E-07
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 556 604 1.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 556 604 1.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 556 604 1.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 556 604 1.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 553 602 1.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 552 601 1.0E-07
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 556 604 1.0E-07
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 547 604 1.0E-07
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 556 604 1.0E-07
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 547 604 1.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 552 604 1.0E-07
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 547 605 1.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 556 604 1.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 556 604 1.0E-07
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 510 604 1.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 552 604 1.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 552 604 1.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 510 604 1.0E-07
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 556 602 1.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 547 605 1.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 556 604 1.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 556 602 1.0E-07
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 547 604 1.0E-07
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 547 602 1.0E-07
sp|P56670|MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus GN=MAZ PE=2 SV=1 547 601 1.0E-07
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 551 602 1.0E-07
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 556 604 1.0E-07
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 556 601 1.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 556 652 1.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 556 604 1.0E-07
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 555 604 1.0E-07
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 556 601 1.0E-07
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 510 601 1.0E-07
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 509 601 1.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 556 611 1.0E-07
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 547 604 1.0E-07
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 506 601 1.0E-07
sp|B2RXF5|ZBT42_HUMAN Zinc finger and BTB domain-containing protein 42 OS=Homo sapiens GN=ZBTB42 PE=1 SV=2 553 604 1.0E-07
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 531 604 1.0E-07
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 539 605 1.0E-07
sp|P08044|SNAI_DROME Protein snail OS=Drosophila melanogaster GN=sna PE=1 SV=2 551 601 1.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 552 605 1.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 556 605 1.0E-07
sp|P19382|SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis GN=snai1 PE=1 SV=1 547 602 1.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 547 604 1.0E-07
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 510 601 1.0E-07
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 553 604 1.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 556 604 1.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 604 1.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 548 602 1.0E-07
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 548 602 1.0E-07
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 547 605 1.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 547 602 1.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 1.0E-07
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 543 609 1.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 537 604 1.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 538 604 1.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 553 604 1.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 556 616 1.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 556 604 1.0E-07
sp|Q567C6|ZN367_DANRE Zinc finger protein 367 OS=Danio rerio GN=znf367 PE=2 SV=1 527 604 1.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 556 610 1.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 556 604 1.0E-07
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 534 604 1.0E-07
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 556 604 1.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 556 604 1.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 551 604 1.0E-07
sp|Q6NRM8|ZB183_XENLA Zinc finger and BTB domain-containing protein 18.3 OS=Xenopus laevis GN=zbtb18.3 PE=2 SV=1 553 604 1.0E-07
sp|Q0IJ29|ZBT18_XENTR Zinc finger and BTB domain-containing protein 18 OS=Xenopus tropicalis GN=zbtb18 PE=2 SV=1 553 604 1.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 552 604 1.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 556 604 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 556 604 2.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 531 604 2.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 551 604 2.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 547 604 2.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 556 604 2.0E-07
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 547 604 2.0E-07
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 553 604 2.0E-07
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 553 604 2.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 546 604 2.0E-07
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 547 604 2.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 556 609 2.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 541 602 2.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 2.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 521 602 2.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 521 602 2.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 553 601 2.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 556 604 2.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 510 604 2.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 507 604 2.0E-07
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 510 604 2.0E-07
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 510 604 2.0E-07
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 510 604 2.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 552 601 2.0E-07
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 521 604 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 556 604 2.0E-07
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 547 601 2.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 510 604 2.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 547 604 2.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 552 601 2.0E-07
sp|Q0VDT2|ZN367_MOUSE Zinc finger protein 367 OS=Mus musculus GN=Znf367 PE=1 SV=2 527 604 2.0E-07
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 547 604 2.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 515 601 2.0E-07
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 556 655 2.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 537 604 2.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 556 601 2.0E-07
sp|Q5U2Z0|ZN367_RAT Zinc finger protein 367 OS=Rattus norvegicus GN=Znf367 PE=2 SV=1 527 604 2.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 547 604 2.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 556 601 2.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 538 605 2.0E-07
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 537 604 2.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 485 601 2.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 556 604 2.0E-07
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 547 604 2.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 556 605 2.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 545 604 2.0E-07
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 549 602 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 553 604 2.0E-07
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 556 604 2.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 510 604 2.0E-07
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 556 605 2.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 536 604 2.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 529 613 2.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 556 602 2.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 551 604 2.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 547 604 2.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 551 604 2.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 547 604 2.0E-07
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 556 604 2.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 551 604 2.0E-07
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 556 604 2.0E-07
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 556 604 2.0E-07
sp|Q7ZWZ4|ZB182_XENLA Zinc finger and BTB domain-containing protein 18.2 OS=Xenopus laevis GN=zbtb18.2 PE=2 SV=2 550 604 2.0E-07
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 556 604 2.0E-07
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 549 604 2.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 556 602 2.0E-07
sp|Q96C28|ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens GN=ZNF707 PE=1 SV=2 553 602 2.0E-07
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 556 604 2.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 556 605 2.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 556 605 2.0E-07
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 547 604 2.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 556 604 2.0E-07
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 549 604 2.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 510 604 2.0E-07
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 542 609 2.0E-07
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 537 604 2.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 556 604 2.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 536 604 2.0E-07
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 546 610 2.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 547 604 2.0E-07
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 510 605 2.0E-07
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 537 604 2.0E-07
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 489 601 2.0E-07
sp|P38082|NRG2_YEAST Probable transcriptional regulator NRG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRG2 PE=1 SV=1 549 604 2.0E-07
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 547 601 2.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 524 604 3.0E-07
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 546 604 3.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 555 604 3.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 556 604 3.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 3.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 510 604 3.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 556 604 3.0E-07
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 546 610 3.0E-07
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 556 605 3.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 547 604 3.0E-07
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 548 604 3.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 537 604 3.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 537 604 3.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 556 603 3.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 510 604 3.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 510 604 3.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 510 604 3.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 3.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 3.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 509 601 3.0E-07
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 556 602 3.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 556 604 3.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 547 604 3.0E-07
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 510 604 3.0E-07
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 510 604 3.0E-07
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 556 604 3.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 556 605 3.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 604 3.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 538 605 3.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 547 602 3.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 556 605 3.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 556 611 3.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 547 604 3.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 547 604 3.0E-07
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 556 604 3.0E-07
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 510 604 3.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 556 692 3.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 510 602 3.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 547 602 3.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 556 602 3.0E-07
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 556 604 3.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 533 605 3.0E-07
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 547 603 3.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 556 602 3.0E-07
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 556 604 3.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 556 604 3.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 510 604 3.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 556 605 3.0E-07
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 556 604 3.0E-07
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 547 603 3.0E-07
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 547 604 3.0E-07
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 556 604 3.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 537 604 3.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 551 604 3.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 547 604 3.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 537 604 3.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 551 604 3.0E-07
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 547 603 3.0E-07
sp|Q96C55|ZN524_HUMAN Zinc finger protein 524 OS=Homo sapiens GN=ZNF524 PE=1 SV=1 547 604 3.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 503 604 3.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 556 604 3.0E-07
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 556 604 3.0E-07
sp|P56270|MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens GN=MAZ PE=1 SV=1 547 601 3.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 556 601 3.0E-07
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 556 604 3.0E-07
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 556 604 3.0E-07
sp|P56671|MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus GN=Maz PE=1 SV=1 547 601 3.0E-07
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 556 604 3.0E-07
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 556 604 3.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 556 604 4.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 556 604 4.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 556 604 4.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 510 604 4.0E-07
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 521 610 4.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 556 604 4.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 556 605 4.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 510 601 4.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 556 602 4.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 604 4.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 604 4.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 556 604 4.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 556 604 4.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 553 604 4.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 556 604 4.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 521 610 4.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 556 604 4.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 556 604 4.0E-07
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 547 601 4.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 556 604 4.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 556 604 4.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 556 610 4.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 556 604 4.0E-07
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 558 604 4.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 556 604 4.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 553 604 4.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 556 604 4.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 610 4.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 509 601 4.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 510 604 4.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 546 604 4.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 547 601 4.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 556 602 4.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 542 615 4.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 556 605 4.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 539 604 4.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 556 605 5.0E-07
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 556 601 5.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 556 604 5.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 556 604 5.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 551 602 5.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 556 604 5.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 556 604 5.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 551 602 5.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 505 604 5.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 556 604 5.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 547 604 5.0E-07
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 541 602 5.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 543 604 5.0E-07
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 543 604 5.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 556 603 5.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 556 604 5.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 545 604 5.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 547 604 5.0E-07
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 556 604 6.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 540 604 6.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 556 604 6.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 521 601 6.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 505 604 6.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 547 604 6.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 556 604 6.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 551 604 6.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 547 602 6.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 551 604 6.0E-07
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 547 602 6.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 544 604 6.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 541 604 6.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 542 604 7.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 553 602 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 604 7.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 547 604 7.0E-07
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 556 604 7.0E-07
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 557 604 7.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 556 604 7.0E-07
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 510 605 7.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 551 602 7.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 521 602 7.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 555 603 7.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 556 605 7.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 556 604 7.0E-07
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 547 601 7.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 521 602 7.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 556 613 7.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 496 604 7.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 556 602 7.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 556 605 7.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 551 604 7.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 547 647 7.0E-07
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 543 604 7.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 547 647 7.0E-07
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 543 604 7.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 556 604 8.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 510 604 8.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 556 604 8.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 556 604 8.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 556 604 8.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 556 604 8.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 547 604 8.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 556 604 8.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 556 604 8.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 555 603 8.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 8.0E-07
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 547 601 8.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 556 604 8.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 556 604 8.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 556 604 8.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 547 604 8.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 543 605 8.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 547 604 8.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 556 604 8.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 556 604 9.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 556 605 9.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 556 604 9.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 556 604 9.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 556 604 9.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 556 604 9.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 556 604 9.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 551 602 9.0E-07
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 556 604 9.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 539 604 9.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 510 604 9.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 556 604 9.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 556 604 9.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 541 604 9.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 549 602 9.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 556 605 9.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 556 604 9.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 556 605 9.0E-07
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 552 607 1.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 556 610 1.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 556 604 1.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 547 602 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 510 604 1.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 547 602 1.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 510 614 1.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 510 604 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 604 1.0E-06
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 556 603 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 604 1.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 556 604 1.0E-06
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 556 657 1.0E-06
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 510 653 1.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 556 602 1.0E-06
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 553 604 1.0E-06
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 547 605 1.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 556 604 1.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 529 604 1.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 556 611 1.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 556 611 1.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 556 605 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 510 604 1.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 556 604 1.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 556 604 1.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 547 604 1.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 555 603 1.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 547 604 1.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 521 622 1.0E-06
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 510 602 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 551 602 1.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 556 604 1.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 556 610 1.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 547 604 1.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 539 604 1.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 535 604 1.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 547 602 1.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 556 605 1.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 547 602 1.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 604 1.0E-06
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 547 601 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 556 604 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 556 616 1.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 552 604 1.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 556 605 1.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 467 604 1.0E-06
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 556 604 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 556 604 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 541 604 1.0E-06
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 555 604 1.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 556 604 1.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 556 605 1.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 521 604 1.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 556 602 1.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 556 604 1.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 556 604 1.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 549 602 1.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 556 605 1.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 556 605 1.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 507 604 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 556 637 1.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 541 604 1.0E-06
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 556 604 2.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 556 604 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 556 604 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 556 604 2.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 553 604 2.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 547 604 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 556 604 2.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 556 604 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 556 604 2.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 556 618 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 510 605 2.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 547 604 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 610 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 604 2.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 556 604 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 610 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 542 604 2.0E-06
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 557 604 2.0E-06
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 553 604 2.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 556 618 2.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 556 602 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 556 610 2.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 556 604 2.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 556 604 2.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 556 604 2.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 556 604 2.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 556 604 2.0E-06
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 557 604 2.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 556 602 2.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 556 602 2.0E-06
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 556 604 2.0E-06
sp|Q8K083|ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus GN=Znf536 PE=2 SV=1 547 601 2.0E-06
sp|O15090|ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens GN=ZNF536 PE=1 SV=3 547 601 2.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 556 639 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 555 604 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 556 604 2.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 553 605 2.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 556 602 2.0E-06
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 556 603 2.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 556 604 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 552 601 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 552 604 2.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 552 604 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 553 604 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 521 604 2.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 556 604 2.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 555 603 2.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 555 603 2.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 556 604 2.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 556 604 2.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 553 604 2.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 556 647 2.0E-06
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 547 602 2.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 556 604 2.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 547 604 2.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 547 605 2.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 556 604 2.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 547 602 2.0E-06
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 556 602 2.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 602 2.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 510 604 2.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 510 604 2.0E-06
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 547 604 2.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 553 605 2.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 521 601 2.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 547 647 2.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 556 604 2.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 547 647 2.0E-06
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 556 604 2.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 556 611 2.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 556 605 2.0E-06
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 553 654 2.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 510 604 2.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 553 605 2.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 529 604 2.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 556 604 2.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 556 602 2.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 547 642 3.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 556 604 3.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 547 604 3.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 609 3.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 542 604 3.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 609 3.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 547 603 3.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 556 604 3.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 556 609 3.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 556 604 3.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 544 604 3.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 542 604 3.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 542 604 3.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 542 604 3.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 542 604 3.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 556 604 3.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 529 604 3.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 529 604 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 556 604 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 555 601 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 556 604 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 538 604 3.0E-06
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 510 604 3.0E-06
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 547 604 3.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 555 604 3.0E-06
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 556 604 3.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 556 601 3.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 556 610 3.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 547 604 3.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 547 605 3.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 556 604 3.0E-06
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 547 604 3.0E-06
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 552 604 3.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 556 604 3.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 503 604 3.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 556 610 3.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 556 604 3.0E-06
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 551 604 3.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 537 605 3.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 553 605 3.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 556 604 4.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 545 604 4.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 547 604 4.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 556 610 4.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 556 604 4.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 539 604 4.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 556 604 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 510 604 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 547 601 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 556 604 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 556 604 4.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 530 601 4.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 530 601 4.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 540 604 4.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 553 601 4.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 556 605 4.0E-06
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 510 653 4.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 547 602 4.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 556 602 4.0E-06
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 556 605 4.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 553 602 4.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 556 604 4.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 556 611 4.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 553 605 4.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 556 604 4.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 546 604 4.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 551 604 4.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 551 604 4.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 556 604 4.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 556 604 4.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 556 604 5.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 556 604 5.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 547 635 5.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 556 604 5.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 556 604 5.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 553 604 5.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 556 610 5.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 556 604 5.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 556 604 5.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 441 604 5.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 556 604 5.0E-06
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 553 620 5.0E-06
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 505 604 5.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 556 614 5.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 556 615 5.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 556 604 5.0E-06
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 553 602 5.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 5.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 547 604 5.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 553 601 5.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 556 611 5.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 556 604 5.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 556 605 5.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 556 605 5.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 556 604 5.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 556 605 5.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 556 605 5.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 556 604 5.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 539 604 5.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 547 604 6.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 547 604 6.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 556 605 6.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 547 604 6.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 522 602 6.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 556 604 6.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 556 601 6.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 604 6.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 556 604 6.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 510 604 6.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 556 604 6.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 556 604 6.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 556 604 6.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 538 604 6.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 556 610 6.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 556 604 6.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 556 604 6.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 556 604 6.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 556 604 6.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 521 603 6.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 556 605 6.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 556 604 6.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 556 604 6.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 556 604 6.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 547 602 6.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 556 605 6.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 547 604 6.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 547 610 6.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 547 604 6.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 556 604 6.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 556 604 6.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 547 635 7.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 521 602 7.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 556 602 7.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 556 604 7.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 555 604 7.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 547 610 7.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 510 604 7.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 556 604 7.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 552 601 7.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 556 602 7.0E-06
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 539 601 7.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 510 604 7.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 556 605 7.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 547 602 7.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 555 604 7.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 556 602 7.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 556 604 8.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 556 604 8.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 556 604 8.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 481 602 8.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 553 602 8.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 555 602 8.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 547 604 8.0E-06
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 546 604 8.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 556 604 8.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 547 610 8.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 553 602 8.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 556 604 8.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 547 610 8.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 556 602 8.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 556 604 8.0E-06
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 556 604 8.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 528 604 8.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 556 604 8.0E-06
sp|B4DX44|ZN736_HUMAN Zinc finger protein 736 OS=Homo sapiens GN=ZNF736 PE=2 SV=2 556 602 8.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 547 604 8.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 556 602 8.0E-06
sp|Q96C28|ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens GN=ZNF707 PE=1 SV=2 546 604 8.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 556 604 9.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 555 604 9.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 547 610 9.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 556 604 9.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 556 604 9.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 556 604 9.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 547 601 9.0E-06
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 556 604 9.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 556 604 9.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 556 610 9.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 510 604 9.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 521 605 9.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 556 604 9.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 547 602 9.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 547 657 9.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 556 604 1.0E-05
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 556 602 1.0E-05
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 553 601 1.0E-05
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 556 604 1.0E-05
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 556 604 1.0E-05
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 556 614 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0003676 nucleic acid binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0065007 biological regulation No
GO:0031326 regulation of cellular biosynthetic process No
GO:0043229 intracellular organelle No
GO:0140110 transcription regulator activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044464 cell part No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0044424 intracellular part No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger
STE like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3365
MAPQKPETFMLSTEAQQALPHDAQVALQQVDNLKYFLISAPVDWQPDQYIRRFLLPTGEYVSCVLWNNLFHISGT
DIVRCLSFRFQAFGRPVKNSKKFEEGIFSDLRNLKSGTDASLEEPKSAFLDFLYKNNCIRTQKKQKVFYWYSVPH
DRLFLDALERDLKREKMGQEATTVAVSEPALSFQYDSSQSLYEQLTKTQQANSSSFSAQQTSFAPGQSTSPVMRN
MESMPPPNMMPQSMAPLAEGMDAMVPYDSMPMPSAVTQQVQQVKRDPDFTRVQYNQNGVPMTHGHQRHASMPAYG
LEYSPAPSFVSSQYEDYSNRGISFEPITPPQQALGMAGEPAYIANEETGLYSAIPDHVPGMNGLNGVAQLPPSSM
AGSQFPRSYGTNNVYSVIEGSPTYKQRRRRSSIPPSMSAMAAPPVAGAGAPHRPSDLRRSVSTSVGPVPEGDESA
NNSPPGLSYSASGASLASQQHKDMVDMSRHGTPLSTVDGSPALNPMALQQDYAHVPADDFAGEGSLKGHHRTVSG
TNGVVRRARSATVMELGPYPHKSHSCPIPTCGRLFKRLEHLKRHVRTHTQEKPYICPHCSKAFSRSDNLAQHKRT
HSREDGGESSMNLSAEEEEELSGEDQLGSLEEASPTSEMAYVPGSMGSAAGDSASSNGASSTGNMNQNQGFNSLQ
TLSMPMTISQPATINGVM*
Coding >Hirsu2|3365
ATGGCGCCTCAAAAGCCCGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCATTGCCGCACGATGCTCAGGTT
GCGCTTCAACAGGTCGACAATCTCAAATACTTCCTCATCTCCGCCCCTGTCGATTGGCAGCCTGACCAGTACATC
CGCCGCTTCCTCTTGCCCACGGGCGAGTACGTCTCTTGCGTCTTGTGGAACAACCTCTTCCACATCTCCGGCACC
GACATCGTGCGATGCCTCTCCTTCCGATTCCAGGCCTTCGGCCGGCCCGTCAAGAACTCCAAAAAGTTCGAGGAG
GGCATCTTCTCCGACCTGCGCAACCTCAAGTCGGGCACCGACGCCTCGCTCGAGGAGCCCAAGAGCGCCTTCCTC
GACTTCCTCTACAAGAACAACTGCATCCGGACCCAGAAGAAGCAAAAGGTCTTCTACTGGTACAGCGTGCCGCAT
GACCGCCTCTTCCTGGACGCCCTCGAGCGCGACCTCAAGCGCGAGAAGATGGGCCAGGAGGCCACGACGGTCGCC
GTCAGCGAGCCCGCCCTGTCCTTCCAGTACGACTCGTCGCAGTCGCTGTACGAGCAGTTGACCAAGACGCAACAA
GCCAACTCGTCCTCCTTCAGCGCCCAGCAGACCTCCTTCGCCCCGGGCCAGTCCACGTCGCCGGTCATGAGGAAC
ATGGAGTCGATGCCCCCCCCAAACATGATGCCGCAGTCGATGGCCCCTTTGGCGGAGGGCATGGACGCAATGGTA
CCGTACGACTCGATGCCGATGCCGTCCGCTGTGACGCAGCAAGTTCAGCAGGTCAAGAGGGATCCTGACTTCACC
CGTGTCCAGTACAACCAGAACGGCGTCCCGATGACCCACGGCCACCAGCGCCACGCCTCGATGCCGGCCTACGGC
CTGGAGTACTCGCCCGCCCCCTCCTTCGTCTCCTCCCAGTACGAGGACTACAGCAACCGGGGAATCTCATTCGAG
CCCATCACCCCTCCCCAGCAGGCTCTGGGCATGGCCGGCGAGCCCGCGTACATTGCGAATGAGGAGACGGGCCTC
TACTCGGCCATCCCGGACCACGTGCCGGGCATGAACGGCCTCAACGGCGTCGCCCAGCTGCCGCCCTCGAGCATG
GCCGGCTCGCAGTTCCCCCGCTCCTACGGCACGAACAACGTCTACTCCGTCATCGAGGGCTCGCCCACCTACAAG
CAGAGGCGGCGGCGCTCCTCCATCCCGCCCTCCATGTCGGCCATGGCCGCGCCCCCCGTCGCCGGCGCCGGCGCC
CCCCACCGGCCCTCGGACCTGAGGCGCTCCGTGTCCACCTCGGTCGGCCCGGTCCCCGAGGGCGACGAGTCGGCC
AACAACTCGCCCCCCGGCCTCTCCTACAGCGCCTCGGGCGCCTCCCTGGCCAGCCAGCAGCACAAGGACATGGTC
GACATGTCCCGCCACGGCACCCCCCTCTCCACCGTCGACGGCAGCCCGGCCCTGAACCCCATGGCCCTCCAGCAG
GACTACGCCCACGTGCCCGCCGACGACTTCGCCGGCGAGGGCTCCCTCAAGGGCCACCACCGGACCGTGTCCGGC
ACCAACGGCGTCGTCCGCCGCGCGCGCTCGGCCACCGTCATGGAGCTCGGCCCCTACCCCCACAAGTCTCACTCG
TGTCCCATCCCAACGTGCGGTCGCCTCTTCAAGCGCTTGGAGCACCTGAAGCGACACGTGAGAACACACACCCAA
GAAAAGCCCTACATCTGCCCACATTGTAGCAAAGCCTTCTCCCGATCGGACAATCTTGCCCAGCACAAGCGCACC
CACAGCCGCGAGGACGGCGGCGAGAGCTCGATGAACCTGTCGGCCGAGGAGGAGGAGGAGCTGTCCGGCGAGGAC
CAGCTCGGCTCTCTCGAAGAGGCGTCGCCCACGTCAGAGATGGCCTACGTGCCCGGCTCCATGGGCTCGGCCGCG
GGCGACTCGGCCTCGTCCAACGGCGCCAGCTCGACGGGCAACATGAACCAGAACCAGGGCTTCAATAGCCTGCAA
ACACTGAGCATGCCGATGACCATCAGTCAACCGGCTACGATCAACGGCGTGATGTAG
Transcript >Hirsu2|3365
ATGGCGCCTCAAAAGCCCGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCATTGCCGCACGATGCTCAGGTT
GCGCTTCAACAGGTCGACAATCTCAAATACTTCCTCATCTCCGCCCCTGTCGATTGGCAGCCTGACCAGTACATC
CGCCGCTTCCTCTTGCCCACGGGCGAGTACGTCTCTTGCGTCTTGTGGAACAACCTCTTCCACATCTCCGGCACC
GACATCGTGCGATGCCTCTCCTTCCGATTCCAGGCCTTCGGCCGGCCCGTCAAGAACTCCAAAAAGTTCGAGGAG
GGCATCTTCTCCGACCTGCGCAACCTCAAGTCGGGCACCGACGCCTCGCTCGAGGAGCCCAAGAGCGCCTTCCTC
GACTTCCTCTACAAGAACAACTGCATCCGGACCCAGAAGAAGCAAAAGGTCTTCTACTGGTACAGCGTGCCGCAT
GACCGCCTCTTCCTGGACGCCCTCGAGCGCGACCTCAAGCGCGAGAAGATGGGCCAGGAGGCCACGACGGTCGCC
GTCAGCGAGCCCGCCCTGTCCTTCCAGTACGACTCGTCGCAGTCGCTGTACGAGCAGTTGACCAAGACGCAACAA
GCCAACTCGTCCTCCTTCAGCGCCCAGCAGACCTCCTTCGCCCCGGGCCAGTCCACGTCGCCGGTCATGAGGAAC
ATGGAGTCGATGCCCCCCCCAAACATGATGCCGCAGTCGATGGCCCCTTTGGCGGAGGGCATGGACGCAATGGTA
CCGTACGACTCGATGCCGATGCCGTCCGCTGTGACGCAGCAAGTTCAGCAGGTCAAGAGGGATCCTGACTTCACC
CGTGTCCAGTACAACCAGAACGGCGTCCCGATGACCCACGGCCACCAGCGCCACGCCTCGATGCCGGCCTACGGC
CTGGAGTACTCGCCCGCCCCCTCCTTCGTCTCCTCCCAGTACGAGGACTACAGCAACCGGGGAATCTCATTCGAG
CCCATCACCCCTCCCCAGCAGGCTCTGGGCATGGCCGGCGAGCCCGCGTACATTGCGAATGAGGAGACGGGCCTC
TACTCGGCCATCCCGGACCACGTGCCGGGCATGAACGGCCTCAACGGCGTCGCCCAGCTGCCGCCCTCGAGCATG
GCCGGCTCGCAGTTCCCCCGCTCCTACGGCACGAACAACGTCTACTCCGTCATCGAGGGCTCGCCCACCTACAAG
CAGAGGCGGCGGCGCTCCTCCATCCCGCCCTCCATGTCGGCCATGGCCGCGCCCCCCGTCGCCGGCGCCGGCGCC
CCCCACCGGCCCTCGGACCTGAGGCGCTCCGTGTCCACCTCGGTCGGCCCGGTCCCCGAGGGCGACGAGTCGGCC
AACAACTCGCCCCCCGGCCTCTCCTACAGCGCCTCGGGCGCCTCCCTGGCCAGCCAGCAGCACAAGGACATGGTC
GACATGTCCCGCCACGGCACCCCCCTCTCCACCGTCGACGGCAGCCCGGCCCTGAACCCCATGGCCCTCCAGCAG
GACTACGCCCACGTGCCCGCCGACGACTTCGCCGGCGAGGGCTCCCTCAAGGGCCACCACCGGACCGTGTCCGGC
ACCAACGGCGTCGTCCGCCGCGCGCGCTCGGCCACCGTCATGGAGCTCGGCCCCTACCCCCACAAGTCTCACTCG
TGTCCCATCCCAACGTGCGGTCGCCTCTTCAAGCGCTTGGAGCACCTGAAGCGACACGTGAGAACACACACCCAA
GAAAAGCCCTACATCTGCCCACATTGTAGCAAAGCCTTCTCCCGATCGGACAATCTTGCCCAGCACAAGCGCACC
CACAGCCGCGAGGACGGCGGCGAGAGCTCGATGAACCTGTCGGCCGAGGAGGAGGAGGAGCTGTCCGGCGAGGAC
CAGCTCGGCTCTCTCGAAGAGGCGTCGCCCACGTCAGAGATGGCCTACGTGCCCGGCTCCATGGGCTCGGCCGCG
GGCGACTCGGCCTCGTCCAACGGCGCCAGCTCGACGGGCAACATGAACCAGAACCAGGGCTTCAATAGCCTGCAA
ACACTGAGCATGCCGATGACCATCAGTCAACCGGCTACGATCAACGGCGTGATGTAG
Gene >Hirsu2|3365
ATGGCGCCTCAAAAGCCCGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCATTGCCGCACGATGCTCAGGTT
GCGCTTCAACAGGTCGACAATCGTGAGTAGCGAGAGCCGTCGCCTCGCGCCCTCCGCCTTGCTGACGACGCCGCG
CCTCGCAGTCAAATACTTCCTCATCTCCGCCCCTGTCGATTGGCAGCCTGACCAGTACATCCGCCGCTTCCTCTT
GCCCACGGGCGAGTACGTCTCTTGCGTCTTGTGGTAGGTTCTCCTTCTTCCTGGCCCCGCCCGCGTGCGTCGATG
CGTCATGGCGACTAAGGCGTCCACCAAGGAACAACCTCTTCCACATCTCCGGCACCGACATCGTGCGATGCCTCT
CCTTCCGATTCCAGGCCTTCGGCCGGCCCGTCAAGAACTCCAAAAAGTTCGAGGAGGGCATCTTCTCCGACCTGC
GCAACCTCAAGTCGGGCACCGACGCCTCGCTCGAGGAGCCCAAGAGCGCCTTCCTCGACTTCCTCTACAAGAACA
ACTGCATCCGGACCCAGAAGAAGCAAAAGGTCTTCTACTGGTACAGCGTGCCGCATGACCGCCTCTTCCTGGACG
CCCTCGAGCGCGACCTCAAGCGCGAGAAGATGGGCCAGGAGGCCACGACGGTCGCCGTCAGCGAGCCCGCCCTGT
CCTTCCAGTACGACTCGTCGCAGTCGCTGTACGAGCAGTTGACCAAGACGCAACAAGCCAACTCGTCCTCCTTCA
GCGCCCAGCAGACCTCCTTCGCCCCGGGCCAGTCCACGTCGCCGGTCATGAGGAACATGGAGTCGATGCCCCCCC
CAAACATGATGCCGCAGTCGATGGCCCCTTTGGCGGAGGGCATGGACGCAATGGTACCGTACGACTCGATGCCGA
TGCCGTCCGCTGTGACGCAGCAAGTTCAGCAGGTCAAGAGGGATCCTGACTTCACCCGTGTCCAGTACAACCAGA
ACGGCGTCCCGATGACCCACGGCCACCAGCGCCACGCCTCGATGCCGGCCTACGGCCTGGAGTACTCGCCCGCCC
CCTCCTTCGTCTCCTCCCAGTACGAGGACTACAGCAACCGGGGAATCTCATTCGAGCCCATCACCCCTCCCCAGC
AGGCTCTGGGCATGGCCGGCGAGCCCGCGTACATTGCGAATGAGGAGACGGGCCTCTACTCGGCCATCCCGGACC
ACGTGCCGGGCATGAACGGCCTCAACGGCGTCGCCCAGCTGCCGCCCTCGAGCATGGCCGGCTCGCAGTTCCCCC
GCTCCTACGGCACGAACAACGTCTACTCCGTCATCGAGGGCTCGCCCACCTACAAGCAGAGGCGGCGGCGCTCCT
CCATCCCGCCCTCCATGTCGGCCATGGCCGCGCCCCCCGTCGCCGGCGCCGGCGCCCCCCACCGGCCCTCGGACC
TGAGGCGCTCCGTGTCCACCTCGGTCGGCCCGGTCCCCGAGGGCGACGAGTCGGCCAACAACTCGCCCCCCGGCC
TCTCCTACAGCGCCTCGGGCGCCTCCCTGGCCAGCCAGCAGCACAAGGACATGGTCGACATGTCCCGCCACGGCA
CCCCCCTCTCCACCGTCGACGGCAGCCCGGCCCTGAACCCCATGGCCCTCCAGCAGGACTACGCCCACGTGCCCG
CCGACGACTTCGCCGGCGAGGGCTCCCTCAAGGGCCACCACCGGACCGTGTCCGGCACCAACGGCGTCGTCCGCC
GCGCGCGCTCGGCCACCGTCATGGAGCTCGGCCCCTACCCCCACAAGTCTCACTCGTGTCCCATCCCAACGTGCG
GTCGCCTCTTCAAGCGCTTGGAGCACCTGAAGCGGTAAGAGCAGTCTCGGCTTTTTCTTTTGTCATCTTTGTCTA
CCCGTGTGCCGTGCGACGATCTGACTCGAATCCACATAGACACGTGAGAACACACACCCAAGAAAAGCCCTACAT
CTGCCCACATTGTAGCAAAGCCTTCTCCCGATCGGACAATCTTGCCCAGTATGCTCTCCCCACCTCTCGCTCTTC
TCACTTCATGGACGCGCGCCTTGGTCTGCATTGCTCTCGATTGATTGGGTCGTTTGTTTTGCTCTTGCTCGGTGG
CCTACCACTCTACGTCCCTGGACGATGCGGCGCGCGTGCTGTCGACCGATTCGGGAAAGCCTATGCTAACGCAAC
TCTCGCTCGTAGGCACAAGCGCACCCACAGCCGCGAGGACGGCGGCGAGAGCTCGATGAACCTGTCGGCCGAGGA
GGAGGAGGAGCTGTCCGGCGAGGACCAGCTCGGCTCTCTCGAAGAGGCGTCGCCCACGTCAGAGATGGCCTACGT
GCCCGGCTCCATGGGCTCGGCCGCGGGCGACTCGGCCTCGTCCAACGGCGCCAGCTCGACGGGCAACATGAACCA
GAACCAGGGCTTCAATAGCCTGCAAACACTGAGCATGCCGATGACCATCAGTCAACCGGCTACGATCAACGGCGT
GATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail