Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3354
Gene name
LocationContig_187:5378..6303
Strand+
Gene length (bp)925
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase 4.1E-32 52 256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q50940|CAH_NEIGO Carbonic anhydrase OS=Neisseria gonorrhoeae GN=cah PE=1 SV=2 1 249 2.0E-28
sp|O52538|CAH_PECCA Carbonic anhydrase OS=Pectobacterium carotovorum GN=cah PE=3 SV=1 42 266 2.0E-24
sp|Q6DAJ6|CAH_PECAS Carbonic anhydrase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cah PE=3 SV=1 42 266 2.0E-24
sp|P94170|CAH_NOSS1 Carbonic anhydrase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ecaA PE=3 SV=1 36 262 7.0E-24
sp|Q9FYE3|ATCA3_ARATH Alpha carbonic anhydrase 3 OS=Arabidopsis thaliana GN=ACA3 PE=2 SV=1 50 235 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q50940|CAH_NEIGO Carbonic anhydrase OS=Neisseria gonorrhoeae GN=cah PE=1 SV=2 1 249 2.0E-28
sp|O52538|CAH_PECCA Carbonic anhydrase OS=Pectobacterium carotovorum GN=cah PE=3 SV=1 42 266 2.0E-24
sp|Q6DAJ6|CAH_PECAS Carbonic anhydrase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cah PE=3 SV=1 42 266 2.0E-24
sp|P94170|CAH_NOSS1 Carbonic anhydrase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ecaA PE=3 SV=1 36 262 7.0E-24
sp|Q9FYE3|ATCA3_ARATH Alpha carbonic anhydrase 3 OS=Arabidopsis thaliana GN=ACA3 PE=2 SV=1 50 235 5.0E-23
sp|O04846|ATCA1_ARATH Alpha carbonic anhydrase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=2 36 265 2.0E-22
sp|Q84UV8|NEC3_NICLS Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NEC3 PE=1 SV=1 42 276 3.0E-22
sp|F4JIK2|ATCA4_ARATH Alpha carbonic anhydrase 4 OS=Arabidopsis thaliana GN=ACA4 PE=3 SV=1 41 265 5.0E-22
sp|F4IHR4|ATCA2_ARATH Alpha carbonic anhydrase 2 OS=Arabidopsis thaliana GN=ACA2 PE=2 SV=2 41 235 1.0E-21
sp|Q9FM99|ATCA8_ARATH Alpha carbonic anhydrase 8 OS=Arabidopsis thaliana GN=ACA8 PE=3 SV=3 41 233 2.0E-21
sp|Q9SUB4|ATCA6_ARATH Alpha carbonic anhydrase 6 OS=Arabidopsis thaliana GN=ACA6 PE=3 SV=1 41 248 2.0E-21
sp|Q8L817|ATCA7_ARATH Alpha carbonic anhydrase 7 OS=Arabidopsis thaliana GN=ACA7 PE=2 SV=1 42 234 3.0E-21
sp|F4HUC4|ATCA5_ARATH Alpha carbonic anhydrase 5 OS=Arabidopsis thaliana GN=ACA5 PE=3 SV=1 42 233 2.0E-19
sp|O52535|CAH_KLEPN Carbonic anhydrase OS=Klebsiella pneumoniae GN=cah PE=3 SV=1 42 240 2.0E-16
sp|Q27504|CAH3_CAEEL Putative carbonic anhydrase 3 OS=Caenorhabditis elegans GN=cah-3 PE=3 SV=1 41 260 8.0E-15
sp|P00917|CAH1_HORSE Carbonic anhydrase 1 OS=Equus caballus GN=CA1 PE=1 SV=3 42 267 3.0E-13
sp|Q95323|CAH4_BOVIN Carbonic anhydrase 4 OS=Bos taurus GN=CA4 PE=2 SV=1 69 243 5.0E-13
sp|Q64444|CAH4_MOUSE Carbonic anhydrase 4 OS=Mus musculus GN=Ca4 PE=1 SV=1 49 240 5.0E-13
sp|P48283|CAH4_RABIT Carbonic anhydrase 4 OS=Oryctolagus cuniculus GN=CA4 PE=1 SV=1 69 268 8.0E-13
sp|P48284|CAH4_RAT Carbonic anhydrase 4 OS=Rattus norvegicus GN=Ca4 PE=1 SV=1 49 245 1.0E-12
sp|Q16790|CAH9_HUMAN Carbonic anhydrase 9 OS=Homo sapiens GN=CA9 PE=1 SV=2 46 266 1.0E-12
sp|O43570|CAH12_HUMAN Carbonic anhydrase 12 OS=Homo sapiens GN=CA12 PE=1 SV=1 39 252 2.0E-12
sp|P83299|CAH1_CHIHA Carbonic anhydrase 1 OS=Chionodraco hamatus GN=ca1 PE=1 SV=1 42 252 3.0E-12
sp|Q8CI85|CAH12_MOUSE Carbonic anhydrase 12 OS=Mus musculus GN=Ca12 PE=1 SV=1 39 254 4.0E-12
sp|P22748|CAH4_HUMAN Carbonic anhydrase 4 OS=Homo sapiens GN=CA4 PE=1 SV=2 69 240 7.0E-12
sp|Q8UWA5|CAH2_TRIHK Carbonic anhydrase 2 OS=Tribolodon hakonensis GN=ca2 PE=2 SV=3 42 262 8.0E-12
sp|Q10462|CAH5_CAEEL Putative carbonic anhydrase 5 OS=Caenorhabditis elegans GN=cah-5 PE=3 SV=3 42 267 1.0E-11
sp|Q8VHB5|CAH9_MOUSE Carbonic anhydrase 9 OS=Mus musculus GN=Ca9 PE=2 SV=2 42 265 2.0E-11
sp|P14141|CAH3_RAT Carbonic anhydrase 3 OS=Rattus norvegicus GN=Ca3 PE=1 SV=3 42 251 7.0E-11
sp|P43166|CAH7_HUMAN Carbonic anhydrase 7 OS=Homo sapiens GN=CA7 PE=1 SV=1 42 240 1.0E-10
sp|Q9MZ30|CAH12_RABIT Carbonic anhydrase 12 OS=Oryctolagus cuniculus GN=CA12 PE=2 SV=2 18 266 2.0E-10
sp|Q9ULX7|CAH14_HUMAN Carbonic anhydrase 14 OS=Homo sapiens GN=CA14 PE=1 SV=1 33 233 4.0E-10
sp|P08060|CAH6_SHEEP Carbonic anhydrase 6 OS=Ovis aries GN=CA6 PE=1 SV=1 66 235 4.0E-10
sp|B0BNN3|CAH1_RAT Carbonic anhydrase 1 OS=Rattus norvegicus GN=Ca1 PE=1 SV=1 42 231 4.0E-10
sp|Q5S1S4|CAH3_PIG Carbonic anhydrase 3 OS=Sus scrofa GN=CA3 PE=2 SV=3 42 251 8.0E-10
sp|P20507|CAH1_CHLRE Carbonic anhydrase 1 OS=Chlamydomonas reinhardtii GN=CAH1 PE=1 SV=1 43 264 8.0E-10
sp|P07630|CAH2_CHICK Carbonic anhydrase 2 OS=Gallus gallus GN=CA2 PE=2 SV=3 42 251 1.0E-09
sp|P48282|CAH1_SHEEP Carbonic anhydrase 1 OS=Ovis aries GN=CA1 PE=2 SV=2 38 252 1.0E-09
sp|P16015|CAH3_MOUSE Carbonic anhydrase 3 OS=Mus musculus GN=Ca3 PE=1 SV=3 42 251 1.0E-09
sp|P07451|CAH3_HUMAN Carbonic anhydrase 3 OS=Homo sapiens GN=CA3 PE=1 SV=3 42 252 2.0E-09
sp|Q92051|CAHZ_DANRE Carbonic anhydrase OS=Danio rerio GN=cahz PE=1 SV=2 42 240 2.0E-09
sp|Q5R4U0|CAH10_PONAB Carbonic anhydrase-related protein 10 OS=Pongo abelii GN=CA10 PE=2 SV=1 50 240 2.0E-09
sp|P61215|CAH10_MOUSE Carbonic anhydrase-related protein 10 OS=Mus musculus GN=Ca10 PE=1 SV=1 50 240 2.0E-09
sp|Q9N085|CAH10_MACFA Carbonic anhydrase-related protein 10 OS=Macaca fascicularis GN=CA10 PE=2 SV=1 50 240 2.0E-09
sp|Q9NS85|CAH10_HUMAN Carbonic anhydrase-related protein 10 OS=Homo sapiens GN=CA10 PE=2 SV=1 50 240 2.0E-09
sp|Q1LZA1|CAH1_BOVIN Carbonic anhydrase 1 OS=Bos taurus GN=CA1 PE=2 SV=3 38 252 2.0E-09
sp|P13634|CAH1_MOUSE Carbonic anhydrase 1 OS=Mus musculus GN=Ca1 PE=1 SV=4 42 231 2.0E-09
sp|Q3SZX4|CAH3_BOVIN Carbonic anhydrase 3 OS=Bos taurus GN=CA3 PE=2 SV=3 42 251 3.0E-09
sp|A0JN41|CAH10_BOVIN Carbonic anhydrase-related protein 10 OS=Bos taurus GN=CA10 PE=2 SV=1 50 240 5.0E-09
sp|P07450|CAH3_HORSE Carbonic anhydrase 3 OS=Equus caballus GN=CA3 PE=1 SV=2 42 251 5.0E-09
sp|P00920|CAH2_MOUSE Carbonic anhydrase 2 OS=Mus musculus GN=Ca2 PE=1 SV=4 42 240 6.0E-09
sp|Q9D6N1|CAH13_MOUSE Carbonic anhydrase 13 OS=Mus musculus GN=Ca13 PE=1 SV=1 41 240 7.0E-09
sp|Q9WVT6|CAH14_MOUSE Carbonic anhydrase 14 OS=Mus musculus GN=Ca14 PE=1 SV=1 33 252 7.0E-09
sp|P18915|CAH6_BOVIN Carbonic anhydrase 6 OS=Bos taurus GN=CA6 PE=1 SV=2 66 235 8.0E-09
sp|P00921|CAH2_BOVIN Carbonic anhydrase 2 OS=Bos taurus GN=CA2 PE=1 SV=3 42 257 1.0E-08
sp|P00918|CAH2_HUMAN Carbonic anhydrase 2 OS=Homo sapiens GN=CA2 PE=1 SV=2 42 240 1.0E-08
sp|P23280|CAH6_HUMAN Carbonic anhydrase 6 OS=Homo sapiens GN=CA6 PE=1 SV=3 66 235 1.0E-08
sp|P35219|CAH8_HUMAN Carbonic anhydrase-related protein OS=Homo sapiens GN=CA8 PE=1 SV=3 64 266 1.0E-08
sp|P28651|CAH8_MOUSE Carbonic anhydrase-related protein OS=Mus musculus GN=Ca8 PE=1 SV=5 64 266 2.0E-08
sp|P18761|CAH6_MOUSE Carbonic anhydrase 6 OS=Mus musculus GN=Ca6 PE=1 SV=3 42 234 2.0E-08
sp|Q9ERQ8|CAH7_MOUSE Carbonic anhydrase 7 OS=Mus musculus GN=Ca7 PE=1 SV=2 42 252 2.0E-08
sp|P00922|CAH2_SHEEP Carbonic anhydrase 2 OS=Ovis aries GN=CA2 PE=1 SV=2 42 257 3.0E-08
sp|Q8HY33|CAH1_MONDO Carbonic anhydrase 1 OS=Monodelphis domestica GN=CA1 PE=2 SV=1 41 238 3.0E-08
sp|Q5PPN4|CAH8_RAT Carbonic anhydrase-related protein OS=Rattus norvegicus GN=Ca8 PE=1 SV=3 64 266 5.0E-08
sp|P23470|PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens GN=PTPRG PE=1 SV=4 1 251 9.0E-08
sp|P00919|CAH2_RABIT Carbonic anhydrase 2 OS=Oryctolagus cuniculus GN=CA2 PE=1 SV=3 42 263 2.0E-07
sp|Q05909|PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus GN=Ptprg PE=1 SV=1 1 251 2.0E-07
sp|P07452|CAH1_RABIT Carbonic anhydrase 1 (Fragment) OS=Oryctolagus cuniculus GN=CA1 PE=2 SV=1 66 263 7.0E-07
sp|Q8N1Q1|CAH13_HUMAN Carbonic anhydrase 13 OS=Homo sapiens GN=CA13 PE=1 SV=1 41 252 1.0E-06
sp|P27139|CAH2_RAT Carbonic anhydrase 2 OS=Rattus norvegicus GN=Ca2 PE=1 SV=2 42 240 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3354
MKRFAKLLATLLLCSTTAAVCNYGTAQNPRHQLLPRSAGPTYSYDGQDGPLVWHSLSAANSVCATGKHQSPVNIV
RGAYSTVDGSSLTFRPGSYPGGAEFENLGHTVQVYLDGSVTLNQDVYRIVQFHLHTPSEHHVESEHYSMELHFVA
QSQNQSLAVMAFIVELASDRDKTSDVLAAALGRVQEIPQAGDRTLTDGLNFTTLQNHLSGSKVFQYSGSLTTPPC
SEDVAFNVVSTPLYIGVDLYRALKSVVKFNARFTQAAPGQLNVLQCAHDSFVRDDGPDS*
Coding >Hirsu2|3354
ATGAAACGGTTTGCGAAGCTGCTCGCAACACTCCTGCTCTGTTCCACCACGGCGGCCGTCTGCAACTACGGCACC
GCCCAGAACCCGCGCCACCAGCTTCTCCCTCGCTCGGCCGGCCCGACGTACTCCTATGACGGGCAAGACGGGCCG
CTGGTGTGGCACAGCCTAAGCGCAGCCAACTCCGTCTGTGCCACCGGCAAGCACCAATCGCCCGTCAACATCGTC
CGAGGTGCATATTCCACCGTTGACGGCTCATCCCTGACCTTTCGACCCGGCTCCTACCCCGGGGGCGCCGAGTTC
GAGAACCTCGGGCATACTGTGCAGGTTTACCTGGACGGATCGGTCACTTTGAACCAAGATGTCTATAGAATCGTC
CAGTTCCACCTCCACACGCCGAGTGAGCATCACGTAGAGAGCGAGCATTATTCTATGGAGCTCCATTTCGTGGCC
CAGTCCCAAAACCAATCCCTCGCTGTCATGGCTTTCATCGTCGAGCTCGCCTCCGACCGGGACAAAACCTCCGAC
GTTCTGGCCGCCGCCCTTGGCAGAGTGCAGGAGATTCCCCAGGCCGGGGATCGGACCCTGACCGACGGCCTCAAC
TTCACCACTCTCCAAAACCACCTGTCCGGTTCCAAGGTGTTCCAGTACAGCGGCTCCCTTACGACGCCGCCCTGC
AGCGAGGACGTCGCGTTCAACGTCGTCAGCACACCTTTGTACATTGGCGTCGACCTCTATCGCGCGCTCAAGAGC
GTTGTCAAGTTCAATGCGCGATTCACGCAGGCCGCGCCGGGCCAGTTGAATGTTTTGCAGTGCGCGCACGATAGC
TTCGTGCGTGACGACGGGCCGGACTCCTAG
Transcript >Hirsu2|3354
ATGAAACGGTTTGCGAAGCTGCTCGCAACACTCCTGCTCTGTTCCACCACGGCGGCCGTCTGCAACTACGGCACC
GCCCAGAACCCGCGCCACCAGCTTCTCCCTCGCTCGGCCGGCCCGACGTACTCCTATGACGGGCAAGACGGGCCG
CTGGTGTGGCACAGCCTAAGCGCAGCCAACTCCGTCTGTGCCACCGGCAAGCACCAATCGCCCGTCAACATCGTC
CGAGGTGCATATTCCACCGTTGACGGCTCATCCCTGACCTTTCGACCCGGCTCCTACCCCGGGGGCGCCGAGTTC
GAGAACCTCGGGCATACTGTGCAGGTTTACCTGGACGGATCGGTCACTTTGAACCAAGATGTCTATAGAATCGTC
CAGTTCCACCTCCACACGCCGAGTGAGCATCACGTAGAGAGCGAGCATTATTCTATGGAGCTCCATTTCGTGGCC
CAGTCCCAAAACCAATCCCTCGCTGTCATGGCTTTCATCGTCGAGCTCGCCTCCGACCGGGACAAAACCTCCGAC
GTTCTGGCCGCCGCCCTTGGCAGAGTGCAGGAGATTCCCCAGGCCGGGGATCGGACCCTGACCGACGGCCTCAAC
TTCACCACTCTCCAAAACCACCTGTCCGGTTCCAAGGTGTTCCAGTACAGCGGCTCCCTTACGACGCCGCCCTGC
AGCGAGGACGTCGCGTTCAACGTCGTCAGCACACCTTTGTACATTGGCGTCGACCTCTATCGCGCGCTCAAGAGC
GTTGTCAAGTTCAATGCGCGATTCACGCAGGCCGCGCCGGGCCAGTTGAATGTTTTGCAGTGCGCGCACGATAGC
TTCGTGCGTGACGACGGGCCGGACTCCTAG
Gene >Hirsu2|3354
ATGAAACGGTTTGCGAAGCTGCTCGCAACACTCCTGCTCTGTTCCACCACGGCGGCCGTCTGCAACTACGGCACC
GCCCAGAACCCGCGCCACCAGCTTCTCCCTCGCTCGGCCGGCCCGACGTACTCCTATGACGGGCAAGACGGGCCG
CTGGTGTGGCACAGCCTAAGCGCAGCCAACTCCGTCTGTGCCACCGGCAAGCACCAATCGCCCGTCAACATCGTC
CGAGGTGCATATTCCACCGTTGACGGCTCATCCCTGACCTTTCGACCCGGCTCCTACCCCGGGGGCGCCGAGTTC
GAGAACCTCGGGCATACTGTGCAGGTTTACCTGGACGGATCGGTCACTTTGAACCAAGATGTCTATAGAATCGTC
CAGTTCCACCTCCACACGCCGAGTGAGCATCACGTAGAGAGCGAGCATTATTCTATGGAGCTCCATTTCGTGGCC
CAGTCCCAAAGTAAGTTACACACGCACACACTCACGCCACCCAGACCGTCCTCGTAGTCCCAGGACTGCTGATTT
GAAAGACCAATCCCTCGCTGTCATGGCTTTCATCGTCGAGCTCGCCTCCGACCGGGACAAAACCTCCGACGTTCT
GGCCGCCGCCCTTGGCAGAGTGCAGGAGATTCCCCAGGCCGGGGATCGGACCCTGACCGACGGCCTCAACTTCAC
CACTCTCCAAAACCACCTGTCCGGTTCCAAGGTGTTCCAGTACAGCGGCTCCCTTACGACGCCGCCCTGCAGCGA
GGACGTCGCGTTCAACGTCGTCAGCACACCTTTGTACATTGGCGTCGACCTCTATCGCGCGCTCAAGAGCGTTGT
CAAGTTCAATGCGCGATTCACGCAGGCCGCGCCGGGCCAGTTGAATGTTTTGCAGTGCGCGCACGATAGCTTCGT
GCGTGACGACGGGCCGGACTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail