Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3352
Gene name
LocationContig_187:564..2104
Strand+
Gene length (bp)1540
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.3E-12 48 362
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 1.4E-06 161 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 22 351 9.0E-15
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 12 353 3.0E-13
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 34 352 2.0E-12
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 23 204 6.0E-12
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 21 257 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 22 351 9.0E-15
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 12 353 3.0E-13
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 34 352 2.0E-12
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 23 204 6.0E-12
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 21 257 7.0E-12
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 34 352 1.0E-11
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 24 353 2.0E-11
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 14 353 2.0E-11
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 12 273 2.0E-11
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 24 365 9.0E-11
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 14 353 9.0E-11
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 24 353 1.0E-10
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 36 367 2.0E-10
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 34 352 2.0E-10
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 36 353 4.0E-10
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 36 362 5.0E-10
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 36 349 2.0E-09
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 31 353 2.0E-09
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 24 250 2.0E-08
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 36 349 3.0E-08
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 27 353 4.0E-08
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 34 350 5.0E-08
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 12 273 7.0E-08
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 36 349 1.0E-07
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 36 349 3.0E-07
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 36 349 3.0E-07
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 38 295 3.0E-07
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 36 301 4.0E-07
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 42 353 1.0E-06
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 16 353 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 81 103 22
3 110 132 22
4 138 160 22
5 173 195 22
6 205 222 17
7 280 302 22
8 307 329 22
9 336 358 22
10 429 451 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3352
MARLSASIELRSPAPAPAPAPADQRQRHEFSLPPVDGGKHAWFFLAAGFFIEALTWGFPFAFGVFQDYYTTHEPF
AESASQIPIVGTCALGIMYLDIPVVMGLQRLHPTFSRWSPVIGLVIMCISLAGSSFASTPGQLVATQGVLYAVGG
SVAYCPCILYMDEWFVKRKGLAYGVMWSGTGLAGFALPLLLEYFLGRWGFRATLRMWAVALLLLTMPLAYFIKPR
LPPTATEHIKPFQLGFALRRTFVLHQAANLCQALGFFLPAIYLPTYARAIGAGPFFAALTILLVNVASVFGCAAM
GSLTDHLHVTTCLLISAAGSATGTLLLWGLATSLPVLFVFCVIYGLFAGSYTSAWTGIMRQITSDPEPPRPGRRG
STPAAGSGAAFDPTMVLGILSTGRGIGSIVSGPLSQVLIKDLPWKDKAFAGYGTGYGPLIAFTGATAAMSGISFL
WRRLGWM*
Coding >Hirsu2|3352
ATGGCCCGGTTGTCGGCGTCGATCGAGCTCCGGAGCCCCGCCCCGGCCCCGGCCCCGGCCCCGGCGGACCAGCGG
CAGAGGCACGAGTTTTCGCTGCCGCCGGTCGACGGCGGCAAGCACGCCTGGTTCTTCCTCGCCGCCGGCTTCTTC
ATCGAGGCATTGACCTGGGGGTTCCCCTTTGCCTTTGGCGTCTTCCAGGACTATTACACGACGCATGAGCCGTTT
GCCGAGTCGGCGTCGCAGATCCCGATCGTCGGCACCTGCGCCCTGGGCATCATGTACCTCGACATCCCCGTCGTC
ATGGGCCTGCAGCGGCTGCACCCGACCTTCAGCCGGTGGTCGCCCGTGATCGGGCTGGTCATCATGTGCATCTCG
CTGGCCGGCAGCTCGTTCGCCAGCACGCCGGGGCAGCTGGTCGCGACGCAGGGCGTGCTGTACGCGGTGGGCGGG
TCGGTGGCCTACTGCCCCTGCATCCTCTACATGGACGAGTGGTTCGTCAAGCGCAAGGGGCTGGCGTACGGCGTC
ATGTGGTCCGGCACGGGGCTGGCCGGCTTCGCCCTGCCGCTGCTGCTCGAGTACTTCCTCGGCCGCTGGGGCTTC
CGGGCGACGCTGCGGATGTGGGCCGTCGCGCTGCTGCTGCTGACGATGCCGCTGGCCTACTTCATCAAGCCGCGG
CTGCCGCCGACGGCGACGGAGCACATCAAGCCCTTCCAGCTCGGCTTCGCCCTGCGCCGCACCTTCGTCCTGCAC
CAGGCCGCCAACCTGTGCCAGGCCCTCGGCTTCTTCCTGCCGGCCATCTACCTGCCGACGTACGCGCGTGCCATC
GGTGCCGGGCCCTTCTTCGCCGCCCTGACCATCCTTCTGGTCAACGTGGCGTCCGTGTTCGGCTGCGCCGCCATG
GGCTCCCTGACCGACCACCTGCACGTCACCACCTGCCTTCTCATCTCCGCCGCCGGCTCCGCCACCGGCACCCTG
CTGCTCTGGGGGCTGGCCACCTCCCTGCCCGTCCTGTTCGTCTTCTGCGTCATCTACGGCCTCTTCGCCGGCTCC
TACACCTCCGCCTGGACCGGCATCATGCGCCAGATCACCTCCGACCCGGAGCCGCCCCGCCCCGGCCGCCGCGGC
TCCACCCCCGCCGCCGGCTCCGGCGCCGCCTTCGACCCCACCATGGTCCTCGGCATCCTCTCCACCGGCCGCGGC
ATCGGCAGCATCGTCTCCGGGCCGCTCAGCCAGGTCCTAATCAAGGACCTGCCGTGGAAGGACAAGGCCTTTGCC
GGCTACGGCACCGGCTACGGGCCGCTCATCGCCTTCACCGGCGCCACCGCCGCCATGAGCGGCATCTCCTTTCTC
TGGAGGAGGCTGGGCTGGATGTAG
Transcript >Hirsu2|3352
ATGGCCCGGTTGTCGGCGTCGATCGAGCTCCGGAGCCCCGCCCCGGCCCCGGCCCCGGCCCCGGCGGACCAGCGG
CAGAGGCACGAGTTTTCGCTGCCGCCGGTCGACGGCGGCAAGCACGCCTGGTTCTTCCTCGCCGCCGGCTTCTTC
ATCGAGGCATTGACCTGGGGGTTCCCCTTTGCCTTTGGCGTCTTCCAGGACTATTACACGACGCATGAGCCGTTT
GCCGAGTCGGCGTCGCAGATCCCGATCGTCGGCACCTGCGCCCTGGGCATCATGTACCTCGACATCCCCGTCGTC
ATGGGCCTGCAGCGGCTGCACCCGACCTTCAGCCGGTGGTCGCCCGTGATCGGGCTGGTCATCATGTGCATCTCG
CTGGCCGGCAGCTCGTTCGCCAGCACGCCGGGGCAGCTGGTCGCGACGCAGGGCGTGCTGTACGCGGTGGGCGGG
TCGGTGGCCTACTGCCCCTGCATCCTCTACATGGACGAGTGGTTCGTCAAGCGCAAGGGGCTGGCGTACGGCGTC
ATGTGGTCCGGCACGGGGCTGGCCGGCTTCGCCCTGCCGCTGCTGCTCGAGTACTTCCTCGGCCGCTGGGGCTTC
CGGGCGACGCTGCGGATGTGGGCCGTCGCGCTGCTGCTGCTGACGATGCCGCTGGCCTACTTCATCAAGCCGCGG
CTGCCGCCGACGGCGACGGAGCACATCAAGCCCTTCCAGCTCGGCTTCGCCCTGCGCCGCACCTTCGTCCTGCAC
CAGGCCGCCAACCTGTGCCAGGCCCTCGGCTTCTTCCTGCCGGCCATCTACCTGCCGACGTACGCGCGTGCCATC
GGTGCCGGGCCCTTCTTCGCCGCCCTGACCATCCTTCTGGTCAACGTGGCGTCCGTGTTCGGCTGCGCCGCCATG
GGCTCCCTGACCGACCACCTGCACGTCACCACCTGCCTTCTCATCTCCGCCGCCGGCTCCGCCACCGGCACCCTG
CTGCTCTGGGGGCTGGCCACCTCCCTGCCCGTCCTGTTCGTCTTCTGCGTCATCTACGGCCTCTTCGCCGGCTCC
TACACCTCCGCCTGGACCGGCATCATGCGCCAGATCACCTCCGACCCGGAGCCGCCCCGCCCCGGCCGCCGCGGC
TCCACCCCCGCCGCCGGCTCCGGCGCCGCCTTCGACCCCACCATGGTCCTCGGCATCCTCTCCACCGGCCGCGGC
ATCGGCAGCATCGTCTCCGGGCCGCTCAGCCAGGTCCTAATCAAGGACCTGCCGTGGAAGGACAAGGCCTTTGCC
GGCTACGGCACCGGCTACGGGCCGCTCATCGCCTTCACCGGCGCCACCGCCGCCATGAGCGGCATCTCCTTTCTC
TGGAGGAGGCTGGGCTGGATGTAG
Gene >Hirsu2|3352
ATGGCCCGGTTGTCGGCGTCGATCGAGCTCCGGAGCCCCGCCCCGGCCCCGGCCCCGGCCCCGGCGGACCAGCGG
CAGAGGCACGAGTTTTCGCTGCCGCCGGTCGACGGCGGCAAGCACGCCTGGTTCTTCCTCGCCGCCGGCTTCTTC
ATCGAGGCATTGACCTGGGGTGCGTTTTTGTTTCTGGTCTCTGTCCCGGCTGCCCGGGAGGTGTGGACTGACGGC
GGTGGCCCGGGCCGGCTTAGGGTTCCCCTTTGCCTTTGGCGTCTTCCAGGACTATTACACGACGCATGAGCCGTT
TGCCGAGTCGGCGTCGCAGATCCCGATCGTCGGCACCTGCGCCCTGGTGAGTAGTAGCCGGGCGGAGATGCCGGT
TCCTCGTCCTCCCACGTCTCCCCTCCGATATATCCGTGGCCGGGTTCTCAAGAGAGGATAGGGCATCATGTACCT
CGACATCCCCGTCGTCATGGGCCTGCAGCGGCTGCACCCGACCTTCAGCCGGTGGTCGCCCGTGATCGGGCTGGT
CATCATGTGCATCTCGCTGGCCGGCAGCTCGTTCGCCAGCACGCCGGGGCAGCTGGTCGCGACGCAGGGCGTGCT
GTACGCGGTGGGCGGGTCGGTGGCCTACTGCCCCTGCATCCTCTACATGGACGAGTGGTTCGTCAAGCGCAAGGG
GCTGGCGTACGGCGTCATGTGGTCCGGCACGGGGCTGGCCGGCTTCGCCCTGCCGCTGCTGCTCGAGTACTTCCT
CGGCCGCTGGGGCTTCCGGGCGACGCTGCGGATGTGGGCCGTCGCGCTGCTGCTGCTGACGATGCCGCTGGCCTA
CTTCATCAAGCCGCGGCTGCCGCCGACGGCGACGGAGCACATCAAGCCCTTCCAGCTCGGCTTCGCCCTGCGCCG
CACCTTCGTCCTGCACCAGGCCGCCAACCTGTGCCAGGCCCTCGGCTTCTTCCTGCCGGCCATCTACCTGCCGAC
GTACGCGCGTGCCATCGGTGCCGGGCCCTTCTTCGCCGCCCTGACCATCCTTCTGGTCAACGTGGCGTCCGTGTT
CGGCTGCGCCGCCATGGGCTCCCTGACCGACCACCTGCACGTCACCACCTGCCTTCTCATCTCCGCCGCCGGCTC
CGCCACCGGCACCCTGCTGCTCTGGGGGCTGGCCACCTCCCTGCCCGTCCTGTTCGTCTTCTGCGTCATCTACGG
CCTCTTCGCCGGCTCCTACACCTCCGCCTGGACCGGCATCATGCGCCAGATCACCTCCGACCCGGAGCCGCCCCG
CCCCGGCCGCCGCGGCTCCACCCCCGCCGCCGGCTCCGGCGCCGCCTTCGACCCCACCATGGTCCTCGGCATCCT
CTCCACCGGCCGCGGCATCGGCAGCATCGTCTCCGGGCCGCTCAGCCAGGTCCTAATCAAGGACCTGCCGTGGAA
GGACAAGGCCTTTGCCGGCTACGGCACCGGCTACGGGCCGCTCATCGCCTTCACCGGCGCCACCGCCGCCATGAG
CGGCATCTCCTTTCTCTGGAGGAGGCTGGGCTGGATGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail