Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3345
Gene name
LocationContig_1867:485..1859
Strand-
Gene length (bp)1374
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 1.8E-15 280 385
PF05773 RWD RWD domain 5.5E-12 11 144

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 1 396 1.0E-34
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 4 380 3.0E-12
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 4 380 3.0E-12

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3345
MDSSADDDDPRAVELETLAAIYPEMAMRRDAGRFGFELELPVQPAEPVTVLFPAAPRRDDDQQQQPPAAEPVDSL
LVSHLPSLRLRITLPDGYPATRPLEAAVSTTPPWLPASTLAGLERDGLGLWEEAGRDLVAYAYVDHVQRAAEHVF
GAVTARGALEVDPAHKLAVLDYDIKAKRAAFEKETFECGICLDPKKGSRCHKMVDCGHIFCLQCLRDFYNDAVEQ
GNLSFVRCLTPNCAKERAAAAADGGPARPGRKAKDKALVSPSELLQMGLSEETVKRYVSLRYKTELESDKDTVYC
PRQWCSGAARSKKHKKPEGLAFADTSDPESEHEDGGAREEEPEEKAGGGGGGKFNPADLLCVCDDCGFAFCSRCL
QTWHGEFVRCAPRRNKDELTEEEKARRTAATT*
Coding >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGACCCCAAGAAGGGATCTCGTTGC
CACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACGACGCCGTCGAGCAG
GGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGGCGGCGGACGGCGGG
CCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGCAGATGGGCCTGTCG
GAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACGGTCTACTGC
CCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGGCGTTTGCCGACACG
TCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGGCGGGCGGCGGCGGC
GGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCTGCAGCCGCTGCCTG
CAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGGAGGAGGAGAAGGCA
AGACGTACGGCTGCAACCACATGA
Transcript >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGACCCCAAGAAGGGATCTCGTTGC
CACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACGACGCCGTCGAGCAG
GGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGGCGGCGGACGGCGGG
CCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGCAGATGGGCCTGTCG
GAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACGGTCTACTGC
CCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGGCGTTTGCCGACACG
TCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGGCGGGCGGCGGCGGC
GGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCTGCAGCCGCTGCCTG
CAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGGAGGAGGAGAAGGCA
AGACGTACGGCTGCAACCACATGA
Gene >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGGTGAGTCGAGGGCGGCGGGGACG
ACGATGTGGAGGAGCCCCTGTCCCACGCCGTGCGTCGCGAGAAGGGGGCTGACTCGAGCCGGACAGACCCCAAGA
AGGGATCTCGTTGCCACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACG
ACGCCGTCGAGCAGGGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGG
CGGCGGACGGCGGGCCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGC
AGATGGGCCTGTCGGAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGG
ACACGGTCTACTGCCCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGG
CGTTTGCCGACACGTCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGG
CGGGCGGCGGCGGCGGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCT
GCAGCCGCTGCCTGCAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGG
AGGAGGAGAAGGCGTCGGTCGAGTATCTGCAGCTGCACACGAGCCCGTGCCCGACGTGCGGCGCGCCGGCGCAGA
AGACGTACGGCTGCAACCACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail