Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3345
Gene name
LocationContig_1867:485..1859
Strand-
Gene length (bp)1374
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 5.4E-15 280 385
PF05773 RWD RWD domain 4.8E-12 11 144

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 1 396 1.0E-34
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 4 380 3.0E-12
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 4 380 3.0E-12

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6294 0.5875 0.047 0.1019 0.168 0.0209 0.1996 0.3004 0.278 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2384
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4958
Ophiocordyceps australis map64 (Brazil) OphauB2|2871
Ophiocordyceps camponoti-floridani Ophcf2|04881
Ophiocordyceps camponoti-rufipedis Ophun1|7019
Ophiocordyceps kimflemingae Ophio5|7857
Ophiocordyceps subramaniannii Hirsu2|3345 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3345
MDSSADDDDPRAVELETLAAIYPEMAMRRDAGRFGFELELPVQPAEPVTVLFPAAPRRDDDQQQQPPAAEPVDSL
LVSHLPSLRLRITLPDGYPATRPLEAAVSTTPPWLPASTLAGLERDGLGLWEEAGRDLVAYAYVDHVQRAAEHVF
GAVTARGALEVDPAHKLAVLDYDIKAKRAAFEKETFECGICLDPKKGSRCHKMVDCGHIFCLQCLRDFYNDAVEQ
GNLSFVRCLTPNCAKERAAAAADGGPARPGRKAKDKALVSPSELLQMGLSEETVKRYVSLRYKTELESDKDTVYC
PRQWCSGAARSKKHKKPEGLAFADTSDPESEHEDGGAREEEPEEKAGGGGGGKFNPADLLCVCDDCGFAFCSRCL
QTWHGEFVRCAPRRNKDELTEEEKARRTAATT*
Coding >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGACCCCAAGAAGGGATCTCGTTGC
CACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACGACGCCGTCGAGCAG
GGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGGCGGCGGACGGCGGG
CCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGCAGATGGGCCTGTCG
GAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACGGTCTACTGC
CCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGGCGTTTGCCGACACG
TCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGGCGGGCGGCGGCGGC
GGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCTGCAGCCGCTGCCTG
CAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGGAGGAGGAGAAGGCA
AGACGTACGGCTGCAACCACATGA
Transcript >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGACCCCAAGAAGGGATCTCGTTGC
CACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACGACGCCGTCGAGCAG
GGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGGCGGCGGACGGCGGG
CCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGCAGATGGGCCTGTCG
GAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGGACACGGTCTACTGC
CCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGGCGTTTGCCGACACG
TCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGGCGGGCGGCGGCGGC
GGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCTGCAGCCGCTGCCTG
CAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGGAGGAGGAGAAGGCA
AGACGTACGGCTGCAACCACATGA
Gene >Hirsu2|3345
ATGGACAGCAGCGCAGATGACGACGACCCGCGGGCCGTCGAGCTCGAGACGCTCGCCGCCATCTACCCCGAGATG
GCGATGCGGCGCGACGCCGGCCGCTTCGGCTTCGAGCTCGAGCTGCCGGTCCAGCCGGCCGAGCCGGTGACGGTC
CTGTTCCCGGCCGCGCCCCGTCGCGACGACGACCAGCAGCAGCAGCCGCCGGCCGCCGAGCCCGTCGACTCGCTC
CTCGTCTCCCACCTGCCGAGCCTCCGGCTCCGCATCACGCTGCCGGACGGCTACCCGGCGACGCGTCCGCTGGAG
GCGGCCGTCTCGACGACGCCGCCCTGGCTGCCGGCCTCGACCCTGGCCGGCCTCGAGCGTGACGGCCTCGGGCTG
TGGGAGGAGGCCGGGCGCGACCTGGTCGCCTACGCCTACGTCGACCACGTCCAGCGGGCGGCCGAGCACGTCTTC
GGCGCCGTCACGGCGCGCGGCGCGCTCGAGGTCGACCCGGCCCACAAGCTCGCCGTCCTGGACTACGACATCAAG
GCCAAGAGGGCCGCGTTTGAGAAGGAGACGTTTGAGTGCGGCATCTGCCTGGGTGAGTCGAGGGCGGCGGGGACG
ACGATGTGGAGGAGCCCCTGTCCCACGCCGTGCGTCGCGAGAAGGGGGCTGACTCGAGCCGGACAGACCCCAAGA
AGGGATCTCGTTGCCACAAGATGGTCGACTGCGGCCACATCTTCTGCCTGCAGTGCCTGCGCGACTTTTACAACG
ACGCCGTCGAGCAGGGAAACCTGTCGTTTGTGCGATGCCTGACGCCCAACTGCGCCAAGGAACGGGCGGCGGCGG
CGGCGGACGGCGGGCCTGCGCGCCCGGGCCGCAAGGCCAAGGACAAGGCCCTGGTCAGCCCGAGCGAGCTGCTGC
AGATGGGCCTGTCGGAGGAGACGGTCAAGCGGTACGTCTCGCTCAGGTACAAGACGGAACTCGAGTCGGACAAGG
ACACGGTCTACTGCCCGCGGCAGTGGTGCAGCGGGGCGGCGCGGTCCAAGAAGCACAAGAAGCCCGAGGGCCTGG
CGTTTGCCGACACGTCGGACCCCGAGTCGGAGCACGAGGACGGAGGGGCGAGGGAGGAGGAGCCGGAGGAGAAGG
CGGGCGGCGGCGGCGGCGGCAAGTTCAATCCGGCGGACCTGCTGTGCGTGTGCGACGACTGCGGCTTCGCCTTCT
GCAGCCGCTGCCTGCAGACGTGGCACGGCGAGTTCGTGCGGTGCGCGCCGCGGCGCAACAAGGACGAGCTCACGG
AGGAGGAGAAGGCGTCGGTCGAGTATCTGCAGCTGCACACGAGCCCGTGCCCGACGTGCGGCGCGCCGGCGCAGA
AGACGTACGGCTGCAACCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail