Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3333
Gene name
LocationContig_1861:2968..3311
Strand+
Gene length (bp)343
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 2.2E-11 20 86

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0509 0.0363 0.9453 0.0937 0.1413 0.0048 0.0442 0.1421 0.0303 0.0081

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999767

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup534
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5692
Ophiocordyceps australis map64 (Brazil) OphauB2|6244
Ophiocordyceps camponoti-floridani Ophcf2|03044
Ophiocordyceps camponoti-rufipedis Ophun1|2015
Ophiocordyceps kimflemingae Ophio5|8335
Ophiocordyceps subramaniannii Hirsu2|3333 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3333
MKAAILALALAAAVQAGNFNDVPQCAQPCLADSIRKVTKCQPTDLNCACKPDNFAKVRGDAASCVIGKCGQGRLR
EVLDGANRACQGHK*
Coding >Hirsu2|3333
ATGAAGGCCGCCATCCTCGCCCTCGCCCTCGCCGCCGCCGTCCAGGCCGGCAACTTCAACGACGTGCCCCAGTGC
GCCCAGCCTTGCCTGGCTGACTCGATCCGAAAGGTGACCAAGTGCCAGCCCACCGACCTCAACTGCGCCTGCAAG
CCCGACAACTTCGCCAAGGTCAGGGGCGACGCCGCGTCTTGTGTCATTGGCAAGTGTGGCCAGGGCAGACTCAGG
GAGGTCCTGGACGGTGCCAACAGGGCTTGCCAGGGACACAAGTGA
Transcript >Hirsu2|3333
ATGAAGGCCGCCATCCTCGCCCTCGCCCTCGCCGCCGCCGTCCAGGCCGGCAACTTCAACGACGTGCCCCAGTGC
GCCCAGCCTTGCCTGGCTGACTCGATCCGAAAGGTGACCAAGTGCCAGCCCACCGACCTCAACTGCGCCTGCAAG
CCCGACAACTTCGCCAAGGTCAGGGGCGACGCCGCGTCTTGTGTCATTGGCAAGTGTGGCCAGGGCAGACTCAGG
GAGGTCCTGGACGGTGCCAACAGGGCTTGCCAGGGACACAAGTGA
Gene >Hirsu2|3333
ATGAAGGCCGCCATCCTCGCCCTCGCCCTCGCCGCCGCCGTCCAGGCCGGCAACTTCAACGACGTGCCCCAGTGC
GCCCAGCCTTGCCTGGCTGACTCGATCCGAAAGGTGACCAAGTGCCAGCCCACCGACCTCAACTGCGCCTGCAAG
CCCGACAACTTCGCCAAGGTCAGGGGCGACGCCGCGTCTTGTGTCATTGGCAAGTGTGGCCAGGGCAGACTCAGT
AAGTCGTCGGCCGCGCCCGCGAGTTCGCTGTTGTGGACGTCGGCTGATCTCGACCGTCCCTTCGCTCTTAGGGGA
GGTCCTGGACGGTGCCAACAGGGCTTGCCAGGGACACAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail