Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3329
Gene name
LocationContig_186:26065..27447
Strand-
Gene length (bp)1382
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 1.2E-16 213 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 206 396 2.0E-09
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 229 400 2.0E-09
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 209 404 1.0E-07
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 348 396 3.0E-07
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 348 401 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 206 396 2.0E-09
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 229 400 2.0E-09
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 209 404 1.0E-07
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 348 396 3.0E-07
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 348 401 7.0E-07
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 348 401 7.0E-07
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 348 401 8.0E-07
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 347 401 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3329
MRLFLFFAALPLAAAIPPKPTRTEGQVIPTGQGGPDGEVAPQDQQRPSNVEPEDQKGPDGNISITLTGREGELPK
SITVDGETVEMEQADGADDVTRRWSYVNPNYRGRPNRNDWGWNPEQSYRGRGNQWHNNNRRPANDYGNAGNQWHN
NNRRPANDYGNAGNQWYNNNNRRPANDYGNAGNQRGQAREPGEILTFYNSPHIFYEDFKKMTLDLHNKARNKHQN
TDSLVWNEELAEDARRYSARCVYEHGHSDVGSGKRWGQNIAYSSWLSGSHNRQIPDEEKTPFYNAEEYLKRSFVH
WWDWERFLYNWWNTREASSSLPVNDARGQEIMSWLQRKYPGKQIPPQVGHFTQIVWRETTEVGCAVTVCQPVRGP
GVSPNHIGTFTVCNYAPSGNIYMDPPPQNSHRYTLYDTNVAWPQNWTTWWSELDNRVEEGEV*
Coding >Hirsu2|3329
ATGCGCCTGTTTCTGTTTTTCGCGGCGCTCCCGCTTGCGGCGGCCATTCCACCAAAACCAACCCGCACGGAGGGC
CAAGTTATCCCCACAGGTCAGGGAGGCCCCGATGGTGAAGTTGCTCCCCAGGATCAGCAACGCCCGTCAAACGTA
GAGCCCGAAGATCAGAAAGGCCCGGATGGCAATATTTCCATTACCCTGACTGGACGGGAGGGCGAACTCCCCAAA
AGCATTACAGTGGACGGGGAAACGGTGGAGATGGAGCAAGCCGATGGCGCTGACGACGTGACCCGACGATGGTCC
TACGTGAACCCCAACTACCGAGGTCGGCCGAACCGCAATGATTGGGGCTGGAACCCCGAGCAATCGTACCGGGGG
CGAGGGAACCAGTGGCACAACAACAATAGACGTCCTGCGAATGATTACGGCAACGCGGGAAACCAATGGCACAAC
AACAATAGACGTCCTGCGAATGATTACGGCAACGCAGGAAACCAGTGGTACAACAACAACAACAGACGTCCTGCG
AATGACTATGGCAACGCGGGAAACCAGCGGGGCCAGGCCCGTGAGCCCGGGGAGATCTTGACCTTTTACAACAGC
CCTCACATCTTCTACGAGGACTTCAAAAAAATGACACTCGACTTGCACAACAAGGCCCGGAACAAGCACCAGAAC
ACTGATTCTCTCGTCTGGAACGAAGAACTGGCGGAAGACGCACGAAGGTATTCTGCCCGCTGCGTGTACGAACAC
GGGCATTCCGACGTTGGGTCAGGGAAACGCTGGGGCCAAAACATTGCCTATTCTTCGTGGTTGAGCGGATCTCAC
AATCGCCAAATACCGGATGAGGAGAAAACCCCCTTTTATAATGCTGAAGAATATTTGAAAAGAAGTTTTGTCCAC
TGGTGGGATTGGGAAAGGTTTCTTTACAACTGGTGGAACACCCGCGAGGCATCATCGTCACTTCCGGTCAACGAT
GCCCGGGGGCAGGAAATCATGAGCTGGCTACAAAGGAAGTATCCGGGGAAACAGATACCACCTCAGGTCGGACAT
TTCACTCAGATTGTCTGGAGAGAAACCACCGAGGTCGGCTGCGCCGTTACTGTATGCCAGCCAGTGCGTGGCCCT
GGGGTTTCACCCAACCATATCGGCACGTTTACTGTCTGCAATTATGCCCCATCAGGCAATATCTATATGGATCCC
CCACCCCAAAATTCTCATAGGTACACCTTGTACGATACAAATGTTGCATGGCCACAGAACTGGACGACATGGTGG
TCTGAACTTGATAATAGGGTTGAAGAGGGAGAAGTATAG
Transcript >Hirsu2|3329
ATGCGCCTGTTTCTGTTTTTCGCGGCGCTCCCGCTTGCGGCGGCCATTCCACCAAAACCAACCCGCACGGAGGGC
CAAGTTATCCCCACAGGTCAGGGAGGCCCCGATGGTGAAGTTGCTCCCCAGGATCAGCAACGCCCGTCAAACGTA
GAGCCCGAAGATCAGAAAGGCCCGGATGGCAATATTTCCATTACCCTGACTGGACGGGAGGGCGAACTCCCCAAA
AGCATTACAGTGGACGGGGAAACGGTGGAGATGGAGCAAGCCGATGGCGCTGACGACGTGACCCGACGATGGTCC
TACGTGAACCCCAACTACCGAGGTCGGCCGAACCGCAATGATTGGGGCTGGAACCCCGAGCAATCGTACCGGGGG
CGAGGGAACCAGTGGCACAACAACAATAGACGTCCTGCGAATGATTACGGCAACGCGGGAAACCAATGGCACAAC
AACAATAGACGTCCTGCGAATGATTACGGCAACGCAGGAAACCAGTGGTACAACAACAACAACAGACGTCCTGCG
AATGACTATGGCAACGCGGGAAACCAGCGGGGCCAGGCCCGTGAGCCCGGGGAGATCTTGACCTTTTACAACAGC
CCTCACATCTTCTACGAGGACTTCAAAAAAATGACACTCGACTTGCACAACAAGGCCCGGAACAAGCACCAGAAC
ACTGATTCTCTCGTCTGGAACGAAGAACTGGCGGAAGACGCACGAAGGTATTCTGCCCGCTGCGTGTACGAACAC
GGGCATTCCGACGTTGGGTCAGGGAAACGCTGGGGCCAAAACATTGCCTATTCTTCGTGGTTGAGCGGATCTCAC
AATCGCCAAATACCGGATGAGGAGAAAACCCCCTTTTATAATGCTGAAGAATATTTGAAAAGAAGTTTTGTCCAC
TGGTGGGATTGGGAAAGGTTTCTTTACAACTGGTGGAACACCCGCGAGGCATCATCGTCACTTCCGGTCAACGAT
GCCCGGGGGCAGGAAATCATGAGCTGGCTACAAAGGAAGTATCCGGGGAAACAGATACCACCTCAGGTCGGACAT
TTCACTCAGATTGTCTGGAGAGAAACCACCGAGGTCGGCTGCGCCGTTACTGTATGCCAGCCAGTGCGTGGCCCT
GGGGTTTCACCCAACCATATCGGCACGTTTACTGTCTGCAATTATGCCCCATCAGGCAATATCTATATGGATCCC
CCACCCCAAAATTCTCATAGGTACACCTTGTACGATACAAATGTTGCATGGCCACAGAACTGGACGACATGGTGG
TCTGAACTTGATAATAGGGTTGAAGAGGGAGAAGTATAG
Gene >Hirsu2|3329
ATGCGCCTGTTTCTGTTTTTCGCGGCGCTCCCGCTTGCGGCGGCCATTCCACCAAAACCAACCCGCACGGAGGGC
CAAGTTATCCCCACAGGTCAGGGAGGCCCCGATGGTGAAGTTGCTCCCCAGGATCAGCAACGCCCGTCAAACGTA
GAGCCCGAAGATCAGAAAGGCCCGGATGGCAATATTTCCATTACCCTGACTGGACGGGAGGGCGAACTCCCCAAA
AGCATTACAGTGGACGGGGAAACGGTGGAGATGGAGCAAGCCGATGGCGCTGACGACGTGACCCGACGATGGTCC
TACGTGAACCCCAACTACCGAGGTCGGCCGAACCGCAATGATTGGGGCTGGAACCCCGAGCAATCGTACCGGGGG
CGAGGGAACCAGTGGCACAACAACAATAGACGTCCTGCGAATGATTACGGCAACGCGGGAAACCAATGGCACAAC
AACAATAGACGTCCTGCGAATGATTACGGCAACGCAGGAAACCAGTGGTACAACAACAACAACAGACGTCCTGCG
AATGACTATGGCAACGCGGGAAACCAGCGGGGCCAGGCCCGTGAGCCCGGGGAGATCTTGACCTTTTACAACAGC
CCTCACATCTTCTACGAGGACTTCAAAAAAATGACACTCGACTTGCACAACAAGGCCCGGAACAAGCACCAGAAC
ACTGATTCTCTCGTCTGGAACGAAGAACTGGCGGAAGACGCACGAAGGTATTCTGCCCGCTGCGTGTACGAACAC
GGGCATTCCGACGTTGGGTCAGGGAAACGCTGGGGCCAAAACATTGCCTATTCTTCGTGGTTGAGCGGATCTCAC
AATCGCCAAATACCGGATGAGGAGAAAACCCCCTTTTATAATGCTGAAGAATATTTGAAAAGAAGTTTTGTCCAC
TGGTGGGATTGGGAAAGGTTTCTTTACAACTGGTGGAACACCCGCGAGGCATCATCGTCACTTCCGGTCAACGAT
GCCCGGGGGCAGGAAATCATGAGCTGGCTACAAAGGAAGTATCCGGGGAAACAGATACCACCTCAGGTCGGACAT
TTCACTCAGATTGTCTGGAGAGAAACCACCGAGGTCGGCTGCGCCGTTACTGTATGCCAGCCAGTGCGTGGCCCT
GGGGTTTCACCCAACCATATCGGCACGTTTACTGTCTGCAATTATGCCCCATCAGGTGAGCTTAAGTATCCCCTG
GCGAGCGAATCAGCTTGCCTCCTCACTTGTGCTAATGAAACGGTGCAGGCAATATCTATATGGATCCCCCACCCC
AAAATTCTCATAGGTACACCTTGTACGATACAAATGTTGCATGGCCACAGAACTGGACGACATGGTGGTCTGAAC
TTGATAATAGGGTTGAAGAGGGAGAAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail