Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3328
Gene name
LocationContig_186:23297..24209
Strand-
Gene length (bp)912
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 3.0E-25 2 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 1 129 3.0E-11
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 1 129 5.0E-11
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 3 124 2.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7091 0.511 0.2947 0.0393 0.2506 0.0156 0.0682 0.085 0.127 0.0477

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6098
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00024
Ophiocordyceps camponoti-floridani Ophcf2|00025
Ophiocordyceps camponoti-rufipedis Ophun1|5086
Ophiocordyceps kimflemingae Ophio5|4082
Ophiocordyceps subramaniannii Hirsu2|3328 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3328
MHILCIHGLAINSDVFETKTEKLRSLLPDDYTYEWLDGIYHVKPLDIFYAYHSGPYLSHTNGVTTDEVASALSRI
DEFIKDNGPFDGVMGACEGAWLVASLLFKHQIENPTSPMPFRFAVFISGSLPLSWSSSVGHDYLGVITSDDPLTT
DASLWRKQNQNEMESERLSEIQDRIRRDLSPEWELRLAKALNLVADPQNSHLRPRAFHPDLYPGRLDLPTAHIWG
REDFIAGHSKQLLRLCNSKFAEAFEHKEGHDVPQSSEDNIRMSEVIQKTIVRSQFAI*
Coding >Hirsu2|3328
ATGCACATCCTTTGCATTCACGGGCTGGCGATCAACAGCGATGTGTTCGAGACGAAGACCGAAAAGCTCAGGTCC
CTGCTACCGGATGATTATACGTACGAGTGGCTGGATGGAATATACCACGTCAAGCCTCTCGACATCTTTTACGCC
TATCATTCCGGCCCATATCTATCACACACAAACGGCGTTACAACTGACGAAGTCGCCAGCGCGCTTTCCCGAATA
GACGAGTTCATCAAAGACAATGGTCCATTCGATGGAGTGATGGGAGCATGTGAAGGTGCTTGGCTCGTCGCATCT
CTGCTTTTCAAGCATCAGATCGAGAACCCGACCTCACCGATGCCGTTTCGATTCGCGGTCTTCATCAGCGGCTCT
CTTCCCCTCTCGTGGAGCAGCTCGGTCGGCCACGACTACCTCGGCGTCATCACGAGCGACGATCCTCTGACCACC
GACGCTTCGCTTTGGCGGAAACAAAACCAGAATGAGATGGAGAGCGAGCGGTTGTCAGAAATACAGGACAGGATT
CGGCGTGACTTGAGCCCGGAGTGGGAGCTTCGGCTGGCAAAGGCCCTGAATCTCGTGGCTGATCCTCAGAACTCT
CACCTCAGGCCGCGCGCATTCCACCCCGATCTGTATCCAGGTAGGCTCGACCTGCCTACTGCCCACATATGGGGT
CGGGAAGATTTTATAGCCGGGCACTCGAAGCAGCTTCTCCGGCTATGCAACTCCAAGTTCGCTGAGGCCTTCGAG
CACAAGGAAGGTCATGACGTTCCTCAGTCAAGCGAGGATAACATACGAATGAGCGAAGTAATCCAGAAAACTATT
GTCAGAAGTCAATTCGCTATTTAG
Transcript >Hirsu2|3328
ATGCACATCCTTTGCATTCACGGGCTGGCGATCAACAGCGATGTGTTCGAGACGAAGACCGAAAAGCTCAGGTCC
CTGCTACCGGATGATTATACGTACGAGTGGCTGGATGGAATATACCACGTCAAGCCTCTCGACATCTTTTACGCC
TATCATTCCGGCCCATATCTATCACACACAAACGGCGTTACAACTGACGAAGTCGCCAGCGCGCTTTCCCGAATA
GACGAGTTCATCAAAGACAATGGTCCATTCGATGGAGTGATGGGAGCATGTGAAGGTGCTTGGCTCGTCGCATCT
CTGCTTTTCAAGCATCAGATCGAGAACCCGACCTCACCGATGCCGTTTCGATTCGCGGTCTTCATCAGCGGCTCT
CTTCCCCTCTCGTGGAGCAGCTCGGTCGGCCACGACTACCTCGGCGTCATCACGAGCGACGATCCTCTGACCACC
GACGCTTCGCTTTGGCGGAAACAAAACCAGAATGAGATGGAGAGCGAGCGGTTGTCAGAAATACAGGACAGGATT
CGGCGTGACTTGAGCCCGGAGTGGGAGCTTCGGCTGGCAAAGGCCCTGAATCTCGTGGCTGATCCTCAGAACTCT
CACCTCAGGCCGCGCGCATTCCACCCCGATCTGTATCCAGGTAGGCTCGACCTGCCTACTGCCCACATATGGGGT
CGGGAAGATTTTATAGCCGGGCACTCGAAGCAGCTTCTCCGGCTATGCAACTCCAAGTTCGCTGAGGCCTTCGAG
CACAAGGAAGGTCATGACGTTCCTCAGTCAAGCGAGGATAACATACGAATGAGCGAAGTAATCCAGAAAACTATT
GTCAGAAGTCAATTCGCTATTTAG
Gene >Hirsu2|3328
ATGCACATCCTTTGCATTCACGGGCTGGCGATCAACAGCGATGTGTTCGAGACGAAGACCGAAAAGCTCAGGTCC
CTGCTACCGGATGATTATACGTACGAGTGGCTGGATGGAATATACCACGTCAAGCCTCTCGACATCTTTTACGCC
TATCATTCCGGCCCATATCTATCACACACAAACGGCGTTACAACTGACGAAGTCGCCAGCGCGCTTTCCCGAATA
GACGAGTTCATCAAAGACAATGGTCCATTCGATGGAGTGATGGGAGCATGTGAAGTACGTCTTCGTGCCCCGCGC
ACGACATGGTGACAGCAGACTAACTCGAGGGCGTGATCATAGGGTGCTTGGCTCGTCGCATCTCTGCTTTTCAAG
CATCAGATCGAGAACCCGACCTCACCGATGCCGTTTCGATTCGCGGTCTTCATCAGCGGCTCTCTTCCCCTCTCG
TGGAGCAGCTCGGTCGGCCACGACTACCTCGGCGTCATCACGAGCGACGATCCTCTGACCACCGACGCTTCGCTT
TGGCGGAAACAAAACCAGAATGAGATGGAGAGCGAGCGGTTGTCAGAAATACAGGACAGGATTCGGCGTGACTTG
AGCCCGGAGTGGGAGCTTCGGCTGGCAAAGGCCCTGAATCTCGTGGCTGATCCTCAGAACTCTCACCTCAGGCCG
CGCGCATTCCACCCCGATCTGTATCCAGGTAGGCTCGACCTGCCTACTGCCCACATATGGGGTCGGGAAGATTTT
ATAGCCGGGCACTCGAAGCAGCTTCTCCGGCTATGCAACTCCAAGTTCGCTGAGGCCTTCGAGCACAAGGAAGGT
CATGACGTTCCTCAGTCAAGCGAGGATAACATACGAATGAGCGAAGTAATCCAGAAAACTATTGTCAGAAGTCAA
TTCGCTATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail