Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3326
Gene name
LocationContig_186:16352..17717
Strand-
Gene length (bp)1365
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 1.5E-46 95 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 10 449 4.0E-66
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 15 443 3.0E-54
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 45 453 7.0E-52
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 45 453 2.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 447 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 10 449 4.0E-66
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 15 443 3.0E-54
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 45 453 7.0E-52
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 45 453 2.0E-50
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 447 1.0E-40
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 15 384 1.0E-33
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 14 388 2.0E-33
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 14 388 2.0E-33
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 14 388 2.0E-33
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 14 388 2.0E-33
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 14 354 2.0E-33
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 15 384 3.0E-33
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 16 390 4.0E-33
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 14 381 5.0E-33
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 15 447 6.0E-31
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 49 447 6.0E-30
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 89 442 1.0E-29
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 89 442 3.0E-29
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 62 390 6.0E-29
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 62 390 1.0E-28
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 56 390 3.0E-28
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 70 444 8.0E-28
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 80 352 2.0E-27
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 62 390 1.0E-26
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 78 352 1.0E-26
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 389 3.0E-26
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 4 352 3.0E-26
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 95 390 8.0E-26
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 4 444 1.0E-25
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 93 433 1.0E-25
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 62 390 3.0E-25
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 81 352 1.0E-24
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 3 342 2.0E-24
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 43 390 3.0E-24
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 81 384 3.0E-24
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 93 415 4.0E-24
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2 354 4.0E-24
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 95 412 1.0E-23
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 95 412 1.0E-23
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 80 390 1.0E-23
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 93 390 2.0E-23
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 93 425 2.0E-23
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 67 433 2.0E-23
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 93 441 2.0E-23
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 95 391 3.0E-23
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 93 390 5.0E-23
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 55 434 7.0E-23
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 96 412 9.0E-23
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 93 415 1.0E-22
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 96 412 1.0E-22
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 15 447 1.0E-22
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 96 412 2.0E-22
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 149 405 2.0E-22
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 22 412 3.0E-22
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 45 389 4.0E-22
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 55 414 5.0E-22
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 96 390 8.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 379 1.0E-21
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 67 444 1.0E-21
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 45 391 6.0E-21
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 96 412 7.0E-21
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 79 412 9.0E-21
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 96 412 2.0E-20
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 56 412 8.0E-20
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 15 390 1.0E-19
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 93 390 2.0E-19
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 16 390 5.0E-19
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 96 392 1.0E-18
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 96 392 2.0E-18
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 13 440 2.0E-18
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 13 440 2.0E-18
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 13 440 2.0E-18
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 95 392 9.0E-18
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 34 384 4.0E-17
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 34 384 4.0E-17
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 34 384 4.0E-17
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 93 318 8.0E-17
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 49 389 2.0E-16
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 14 352 1.0E-15
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 14 352 1.0E-15
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 93 392 2.0E-15
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 15 352 4.0E-15
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 15 352 4.0E-15
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 15 352 4.0E-15
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 93 390 1.0E-14
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 33 352 1.0E-14
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 93 356 3.0E-14
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 33 352 3.0E-14
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 33 352 4.0E-14
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 93 392 2.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 93 318 6.0E-13
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 91 390 4.0E-12
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 94 307 1.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 91 383 2.0E-11
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 94 391 5.0E-10
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 94 391 5.0E-10
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 94 391 6.0E-10
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 94 391 6.0E-10
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 94 391 6.0E-10
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 94 391 7.0E-10
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 94 391 9.0E-10
sp|O13698|FABD_SCHPO Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mct1 PE=3 SV=1 94 319 2.0E-07
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 91 391 2.0E-07
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 91 391 1.0E-06
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 91 391 2.0E-06
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 91 391 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6674 0.2848 0.0936 0.0119 0.2947 0.0173 0.0591 0.188 0.1852 0.0582

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup78
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4899
Ophiocordyceps australis map64 (Brazil) OphauB2|5634
Ophiocordyceps kimflemingae Ophio5|8256
Ophiocordyceps subramaniannii Hirsu2|9925
Ophiocordyceps subramaniannii Hirsu2|9186
Ophiocordyceps subramaniannii Hirsu2|8479
Ophiocordyceps subramaniannii Hirsu2|7364
Ophiocordyceps subramaniannii Hirsu2|6703
Ophiocordyceps subramaniannii Hirsu2|6204
Ophiocordyceps subramaniannii Hirsu2|11185
Ophiocordyceps subramaniannii Hirsu2|4298
Ophiocordyceps subramaniannii Hirsu2|3326 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3276
Ophiocordyceps subramaniannii Hirsu2|3122
Ophiocordyceps subramaniannii Hirsu2|24
Ophiocordyceps subramaniannii Hirsu2|1531
Ophiocordyceps subramaniannii Hirsu2|5152
Ophiocordyceps subramaniannii Hirsu2|5593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3326
MTNKPDAVENETRVFVLSAPEKEAIARQSQAHADHVEARGTADMLKHYAYTLAERRSTFQWRHAVVAGSVDELVA
RWRDQDIKAVKAEARTNMAFVFTGQGAQWYAMGRELISFDVYASSVRQSAACLAALGCPWDAWNELMKSESTSNV
NQAGFSQPLCTVLQIALVDLLEHWGIKPSAVIGHSSGEIAAAYASQALSREDCLSVAYQRGVVSEVAKIRCPGGS
MMAVGLSTQEVQSYLTRPKAPVVVGCVNSPGNVTLTGDRASLEQLRDIFVQEDIFCRLLQVDNAYHSQQMLSVSD
DYRKSISHITPVESPSVTFYSTVLGRNISTARLTADYWVDNMCSAVEFVSALDDMIYANTVTRQMKRKSVATNVL
VEIGPHGALGGPIKQFKLARGGLDHLDYYSLLSRGKDASLTATTATASLWMKGASVDLTKVRKSLSSSNVRLSVN
TLLQ*
Coding >Hirsu2|3326
ATGACGAACAAGCCCGATGCCGTCGAGAACGAGACTCGCGTCTTCGTGCTCTCGGCCCCAGAGAAGGAGGCCATC
GCTCGGCAGAGCCAGGCACACGCCGACCATGTCGAGGCACGCGGCACAGCCGACATGTTGAAGCACTATGCCTAT
ACCCTTGCCGAGCGCCGGTCTACCTTTCAGTGGCGGCACGCAGTCGTTGCCGGCTCTGTCGACGAACTCGTGGCC
CGATGGAGAGATCAGGACATCAAGGCTGTCAAGGCCGAAGCTCGCACGAACATGGCCTTTGTCTTCACCGGACAA
GGCGCGCAATGGTACGCCATGGGCCGCGAACTCATCTCGTTCGACGTGTACGCGTCATCTGTCCGACAGTCTGCC
GCCTGCCTGGCTGCCTTGGGCTGTCCGTGGGACGCCTGGAACGAGCTCATGAAGTCCGAGTCTACGTCCAACGTG
AATCAGGCCGGCTTTTCCCAGCCTCTCTGCACAGTCCTCCAGATAGCCCTTGTTGACCTTCTGGAGCACTGGGGC
ATCAAACCTTCCGCCGTCATCGGCCACTCGTCAGGAGAGATTGCCGCCGCCTACGCCTCCCAGGCCTTATCCCGA
GAAGATTGCCTAAGCGTTGCCTACCAGCGCGGCGTCGTTTCCGAGGTGGCCAAGATACGTTGCCCCGGCGGTTCT
ATGATGGCCGTTGGTCTATCAACGCAAGAGGTCCAGTCGTATCTGACCCGGCCCAAAGCTCCCGTCGTGGTGGGA
TGCGTCAACAGCCCCGGCAATGTCACCCTTACAGGCGATAGGGCAAGTTTAGAACAATTGCGGGACATTTTCGTC
CAGGAAGACATATTCTGCCGTCTGCTTCAGGTAGACAATGCCTACCACAGCCAGCAGATGCTCAGCGTCAGCGAC
GACTATCGGAAGAGCATCAGCCACATTACACCTGTCGAAAGCCCGTCCGTCACTTTCTACTCTACCGTTTTGGGA
CGAAATATCTCGACCGCCCGGCTCACAGCCGACTACTGGGTCGATAATATGTGTTCGGCAGTCGAGTTTGTGTCG
GCCCTCGACGACATGATATATGCAAACACCGTGACGAGACAAATGAAGAGAAAGTCCGTCGCAACGAACGTCCTG
GTCGAAATTGGCCCCCACGGAGCACTAGGCGGCCCGATCAAGCAATTCAAACTGGCCCGCGGCGGCCTGGACCAC
TTAGACTACTACTCTCTCCTATCCCGGGGAAAGGATGCCTCTCTTACGGCTACGACGGCCACTGCCTCATTATGG
ATGAAAGGCGCATCGGTCGATCTGACCAAGGTAAGAAAGAGTCTCTCTTCCTCCAATGTCCGGCTTTCTGTTAAC
ACGCTGCTGCAATAG
Transcript >Hirsu2|3326
ATGACGAACAAGCCCGATGCCGTCGAGAACGAGACTCGCGTCTTCGTGCTCTCGGCCCCAGAGAAGGAGGCCATC
GCTCGGCAGAGCCAGGCACACGCCGACCATGTCGAGGCACGCGGCACAGCCGACATGTTGAAGCACTATGCCTAT
ACCCTTGCCGAGCGCCGGTCTACCTTTCAGTGGCGGCACGCAGTCGTTGCCGGCTCTGTCGACGAACTCGTGGCC
CGATGGAGAGATCAGGACATCAAGGCTGTCAAGGCCGAAGCTCGCACGAACATGGCCTTTGTCTTCACCGGACAA
GGCGCGCAATGGTACGCCATGGGCCGCGAACTCATCTCGTTCGACGTGTACGCGTCATCTGTCCGACAGTCTGCC
GCCTGCCTGGCTGCCTTGGGCTGTCCGTGGGACGCCTGGAACGAGCTCATGAAGTCCGAGTCTACGTCCAACGTG
AATCAGGCCGGCTTTTCCCAGCCTCTCTGCACAGTCCTCCAGATAGCCCTTGTTGACCTTCTGGAGCACTGGGGC
ATCAAACCTTCCGCCGTCATCGGCCACTCGTCAGGAGAGATTGCCGCCGCCTACGCCTCCCAGGCCTTATCCCGA
GAAGATTGCCTAAGCGTTGCCTACCAGCGCGGCGTCGTTTCCGAGGTGGCCAAGATACGTTGCCCCGGCGGTTCT
ATGATGGCCGTTGGTCTATCAACGCAAGAGGTCCAGTCGTATCTGACCCGGCCCAAAGCTCCCGTCGTGGTGGGA
TGCGTCAACAGCCCCGGCAATGTCACCCTTACAGGCGATAGGGCAAGTTTAGAACAATTGCGGGACATTTTCGTC
CAGGAAGACATATTCTGCCGTCTGCTTCAGGTAGACAATGCCTACCACAGCCAGCAGATGCTCAGCGTCAGCGAC
GACTATCGGAAGAGCATCAGCCACATTACACCTGTCGAAAGCCCGTCCGTCACTTTCTACTCTACCGTTTTGGGA
CGAAATATCTCGACCGCCCGGCTCACAGCCGACTACTGGGTCGATAATATGTGTTCGGCAGTCGAGTTTGTGTCG
GCCCTCGACGACATGATATATGCAAACACCGTGACGAGACAAATGAAGAGAAAGTCCGTCGCAACGAACGTCCTG
GTCGAAATTGGCCCCCACGGAGCACTAGGCGGCCCGATCAAGCAATTCAAACTGGCCCGCGGCGGCCTGGACCAC
TTAGACTACTACTCTCTCCTATCCCGGGGAAAGGATGCCTCTCTTACGGCTACGACGGCCACTGCCTCATTATGG
ATGAAAGGCGCATCGGTCGATCTGACCAAGGTAAGAAAGAGTCTCTCTTCCTCCAATGTCCGGCTTTCTGTTAAC
ACGCTGCTGCAATAG
Gene >Hirsu2|3326
ATGACGAACAAGCCCGATGCCGTCGAGAACGAGACTCGCGTCTTCGTGCTCTCGGCCCCAGAGAAGGAGGCCATC
GCTCGGCAGAGCCAGGCACACGCCGACCATGTCGAGGCACGCGGCACAGCCGACATGTTGAAGCACTATGCCTAT
ACCCTTGCCGAGCGCCGGTCTACCTTTCAGTGGCGGCACGCAGTCGTTGCCGGCTCTGTCGACGAACTCGTGGCC
CGATGGAGAGATCAGGACATCAAGGCTGTCAAGGCCGAAGCTCGCACGAACATGGCCTTTGTCTTCACCGGACAA
GGCGCGCAATGGTACGCCATGGGCCGCGAACTCATCTCGTTCGACGTGTACGCGTCATCTGTCCGACAGTCTGCC
GCCTGCCTGGCTGCCTTGGGCTGTCCGTGGGACGCCTGGAACGAGCTCATGAAGTCCGAGTCTACGTCCAACGTG
AATCAGGCCGGCTTTTCCCAGCCTCTCTGCACAGTCCTCCAGATAGCCCTTGTTGACCTTCTGGAGCACTGGGGC
ATCAAACCTTCCGCCGTCATCGGCCACTCGTCAGGAGAGATTGCCGCCGCCTACGCCTCCCAGGCCTTATCCCGA
GAAGATTGCCTAAGCGTTGCCTACCAGCGCGGCGTCGTTTCCGAGGTGGCCAAGATACGTTGCCCCGGCGGTTCT
ATGATGGCCGTTGGTCTATCAACGCAAGAGGTCCAGTCGTATCTGACCCGGCCCAAAGCTCCCGTCGTGGTGGGA
TGCGTCAACAGCCCCGGCAATGTCACCCTTACAGGCGATAGGGCAAGTTTAGAACAATTGCGGGACATTTTCGTC
CAGGAAGACATATTCTGCCGTCTGCTTCAGGTAGACAATGCCTACCACAGCCAGCAGATGCTCAGCGTCAGCGAC
GACTATCGGAAGAGCATCAGCCACATTACACCTGTCGAAAGCCCGTCCGTCACTTTCTACTCTACCGTTTTGGGA
CGAAATATCTCGACCGCCCGGCTCACAGCCGACTACTGGGTCGATAATATGTGTTCGGCAGTCGAGTTTGTGTCG
GCCCTCGACGACATGATATATGCAAACACCGTGACGAGACAAATGAAGAGAAAGTCCGTCGCAACGAACGTCCTG
GTCGAAATTGGCCCCCACGGAGCACTAGGCGGCCCGATCAAGCAATTCAAACTGGCCCGCGGCGGCCTGGACCAC
TTAGACTACTACTCTCTCCTATCCCGGGGAAAGGATGCCTCTCTTACGGCTACGACGGCCACTGCCTCATTATGG
ATGAAAGGCGCATCGGTCGATCTGACCAAGGTAAGAAAGAGTCTCTCTTCCTCCAATGTCCGGCTTTCTGTTAAC
ACGCTGCTGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail