Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3325
Gene name
LocationContig_186:10957..11584
Strand-
Gene length (bp)627
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-05 113 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 56 180 3.0E-09
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 88 173 8.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3325
MNEFGLTIIDSQHFFHLLQSALASTADSKNSLPGQLLVGACSGGIMQAAQKVNPDAHFSWLQTFASFAYLRELDV
QDEGATEVADKTEDQKLLDQLGRSKSMDEANDTVQQILLSKISKIVSVPVSDINTAKPVHTYGVDSLVAVELRNW
LAMELKSDMSIFDLTSNAPISDVCRKIASRSHLILKN*
Coding >Hirsu2|3325
ATGAATGAATTTGGCTTGACCATAATCGACAGCCAGCACTTCTTCCACCTCCTCCAATCCGCACTGGCCAGCACC
GCCGACAGCAAGAACTCTTTGCCAGGGCAGCTGCTAGTCGGGGCCTGCAGCGGTGGTATCATGCAGGCCGCGCAG
AAAGTGAATCCCGATGCTCACTTTTCCTGGCTCCAGACCTTCGCGTCCTTTGCCTATCTTCGGGAGCTAGACGTC
CAAGACGAAGGCGCGACAGAGGTTGCCGACAAGACCGAGGACCAAAAGCTCCTCGACCAGCTCGGGCGATCCAAA
TCGATGGACGAGGCCAATGACACGGTGCAGCAGATCTTACTATCGAAGATCTCCAAGATCGTGTCGGTGCCGGTC
TCCGACATCAACACGGCCAAGCCGGTTCATACCTACGGCGTCGACAGTCTCGTGGCCGTGGAGCTACGCAATTGG
CTGGCAATGGAGCTCAAGAGTGATATGAGTATTTTTGACCTGACAAGCAACGCCCCGATCAGCGATGTTTGCAGG
AAGATTGCAAGCCGATCACATTTAATTCTGAAGAACTGA
Transcript >Hirsu2|3325
ATGAATGAATTTGGCTTGACCATAATCGACAGCCAGCACTTCTTCCACCTCCTCCAATCCGCACTGGCCAGCACC
GCCGACAGCAAGAACTCTTTGCCAGGGCAGCTGCTAGTCGGGGCCTGCAGCGGTGGTATCATGCAGGCCGCGCAG
AAAGTGAATCCCGATGCTCACTTTTCCTGGCTCCAGACCTTCGCGTCCTTTGCCTATCTTCGGGAGCTAGACGTC
CAAGACGAAGGCGCGACAGAGGTTGCCGACAAGACCGAGGACCAAAAGCTCCTCGACCAGCTCGGGCGATCCAAA
TCGATGGACGAGGCCAATGACACGGTGCAGCAGATCTTACTATCGAAGATCTCCAAGATCGTGTCGGTGCCGGTC
TCCGACATCAACACGGCCAAGCCGGTTCATACCTACGGCGTCGACAGTCTCGTGGCCGTGGAGCTACGCAATTGG
CTGGCAATGGAGCTCAAGAGTGATATGAGTATTTTTGACCTGACAAGCAACGCCCCGATCAGCGATGTTTGCAGG
AAGATTGCAAGCCGATCACATTTAATTCTGAAGAACTGA
Gene >Hirsu2|3325
ATGAATGAATTTGGCTTGGTAAGTTGAGCCTTCCTGCCTTCTACTTGGAAGCTTCAGGAAATATTCTAACAAGCC
CTTCAGACCATAATCGACAGCCAGCACTTCTTCCACCTCCTCCAATCCGCACTGGCCAGCACCGCCGACAGCAAG
AACTCTTTGCCAGGGCAGCTGCTAGTCGGGGCCTGCAGCGGTGGTATCATGCAGGCCGCGCAGAAAGTGAATCCC
GATGCTCACTTTTCCTGGCTCCAGACCTTCGCGTCCTTTGCCTATCTTCGGGAGCTAGACGTCCAAGACGAAGGC
GCGACAGAGGTTGCCGACAAGACCGAGGACCAAAAGCTCCTCGACCAGCTCGGGCGATCCAAATCGATGGACGAG
GCCAATGACACGGTGCAGCAGATCTTACTATCGAAGATCTCCAAGATCGTGTCGGTGCCGGTCTCCGACATCAAC
ACGGCCAAGCCGGTTCATACCTACGGCGTCGACAGTCTCGTGGCCGTGGAGCTACGCAATTGGCTGGCAATGGAG
CTCAAGAGTGATATGAGTATTTTTGACCTGACAAGCAACGCCCCGATCAGCGATGTTTGCAGGAAGATTGCAAGC
CGATCACATTTAATTCTGAAGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail