Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3322
Gene name
LocationContig_186:531..2957
Strand-
Gene length (bp)2426
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 2.3E-30 282 480

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IR18|GRC3_GIBZE Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GRC3 PE=3 SV=2 4 728 0.0E+00
sp|A1CFB5|GRC3_ASPCL Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=grc3 PE=3 SV=1 117 720 4.0E-98
sp|A2QNQ8|GRC3_ASPNC Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=grc3 PE=3 SV=2 113 720 1.0E-96
sp|Q4WID9|GRC3_ASPFU Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=grc3 PE=3 SV=2 117 720 2.0E-96
sp|A1CYR9|GRC3_NEOFI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=grc3 PE=3 SV=1 117 720 3.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IR18|GRC3_GIBZE Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GRC3 PE=3 SV=2 4 728 0.0E+00
sp|A1CFB5|GRC3_ASPCL Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=grc3 PE=3 SV=1 117 720 4.0E-98
sp|A2QNQ8|GRC3_ASPNC Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=grc3 PE=3 SV=2 113 720 1.0E-96
sp|Q4WID9|GRC3_ASPFU Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=grc3 PE=3 SV=2 117 720 2.0E-96
sp|A1CYR9|GRC3_NEOFI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=grc3 PE=3 SV=1 117 720 3.0E-95
sp|Q5B4D1|GRC3_EMENI Polynucleotide 5'-hydroxyl-kinase grc3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grc3 PE=3 SV=1 118 723 3.0E-93
sp|Q0CKU1|GRC3_ASPTN Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=grc3 PE=3 SV=1 112 720 7.0E-93
sp|Q2U0C4|GRC3_ASPOR Polynucleotide 5'-hydroxyl-kinase grc3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=grc3 PE=3 SV=2 118 720 9.0E-92
sp|Q9UU96|GRC3_SCHPO Polynucleotide 5'-hydroxyl-kinase grc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grc3 PE=1 SV=1 130 654 2.0E-40
sp|P0CM78|GRC3_CRYNJ Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GRC3 PE=3 SV=1 136 630 5.0E-23
sp|P0CM79|GRC3_CRYNB Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GRC3 PE=3 SV=1 136 630 5.0E-23
sp|Q8VYP6|NOL9_ARATH Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Arabidopsis thaliana GN=At5g11010 PE=2 SV=1 256 478 3.0E-21
sp|Q54Z27|NOL9_DICDI Polynucleotide 5'-hydroxyl-kinase nol9 OS=Dictyostelium discoideum GN=nol9 PE=3 SV=1 114 429 1.0E-19
sp|Q59U11|GRC3_CANAL Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRC3 PE=3 SV=1 113 724 2.0E-19
sp|Q6BQV7|GRC3_DEBHA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GRC3 PE=3 SV=2 124 724 5.0E-18
sp|Q07845|GRC3_YEAST Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRC3 PE=1 SV=1 227 542 2.0E-17
sp|Q3TZX8|NOL9_MOUSE Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Mus musculus GN=Nol9 PE=1 SV=1 269 623 6.0E-17
sp|Q6CQ06|GRC3_KLULA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRC3 PE=3 SV=1 136 647 2.0E-15
sp|Q6C5P9|GRC3_YARLI Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GRC3 PE=3 SV=1 136 649 3.0E-15
sp|Q753Y3|GRC3_ASHGO Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GRC3 PE=3 SV=1 134 647 8.0E-14
sp|E1BPN0|NOL9_BOVIN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Bos taurus GN=NOL9 PE=3 SV=1 248 434 1.0E-13
sp|Q5SY16|NOL9_HUMAN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1 276 628 2.0E-13
sp|Q6FW56|GRC3_CANGA Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GRC3 PE=3 SV=1 278 431 6.0E-12
sp|A1ZA92|NOL9_DROME Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Drosophila melanogaster GN=CG8414 PE=2 SV=1 189 443 5.0E-09
sp|A8WQV9|NOL9_CAEBR Polynucleotide 5'-hydroxyl-kinase nol-9 OS=Caenorhabditis briggsae GN=nol-9 PE=3 SV=2 277 628 1.0E-08
sp|Q9U3B6|NOL9_CAEEL Polynucleotide 5'-hydroxyl-kinase nol-9 OS=Caenorhabditis elegans GN=nol-9 PE=3 SV=1 274 652 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3322
MPSSPHKRRKVEGSDTPQSAVSAISALAARRRLNASGAADTSSSPPISGPSRTVAAPSNPFSPLQDRQQKRASVT
APSKATPGQGSVRSRRLRERAPAAESVKGSSKSESRPVTYSSFPLSKLNYCIKGDVAELRLEENERFLIVGSFGI
RVVAGEVTVAGAALRPSDCVHYVHAPHCHSLPVLRTAENTSLELHNHPEAKPLRLLGKLSPLFQNIWNDSPPETT
EKRPQGPTTFQILGDSEDAPNGSIVQELVSPPKWNKKLASIVESVSGRQPPSIVVCGPKSSGKSTFSRLLTNRLL
VTANAETSGSTRSMATGVAVLDLDPGQPEYAPPGTVSLVYVTQPNLGVPFTHPSLHDGAFQVLRCHSLASVNPAS
TTDLHLECALDLYDYYRHRLRNCPLIINTPGWVLSLGLELLVEVITKVRPAEVVYMSEDGPTETVDALQGATKNN
FTSLPSQPSEFKSRTAAQYREMQAMSYFHSVCDDGSGGPKRLSWSPHALSSVRPLVVRYSGKGRGFLGILRYDYQ
LAPELIAEAINGVVLAIVEIEQPQAFRCLFQDMAPDVTAKDGDSPCSPLISWSPEGIPFISNPDDVTLDPRHSRT
LGLALVRGVDTANKSLQILTPTPLSSIRGATSRGSSVVLVHGRFDPPTWSYTEHLQELAVEDVAQEQGPEVTEED
TSDEEGDATADDASQREGGTAVPWVETLKGNQKRPVGSKVWRVRRDLGRHTVG*
Coding >Hirsu2|3322
ATGCCGTCTTCGCCTCATAAGAGACGCAAAGTGGAAGGCTCTGACACTCCGCAGTCAGCAGTGAGTGCTATCAGC
GCCCTGGCGGCCCGGCGCCGACTCAATGCTTCTGGAGCGGCCGACACCAGCTCTTCGCCGCCAATCTCGGGCCCC
TCGCGAACCGTCGCCGCCCCTTCAAACCCGTTCAGTCCCCTGCAGGACCGCCAGCAAAAGCGAGCGTCGGTGACG
GCGCCAAGCAAGGCTACGCCCGGCCAGGGCTCTGTCAGAAGCCGAAGGCTGCGCGAGCGAGCGCCTGCGGCGGAG
TCTGTGAAAGGATCGTCCAAGTCAGAATCTCGACCTGTGACGTACTCATCTTTTCCCCTATCGAAGCTCAACTAT
TGCATCAAGGGCGATGTGGCAGAACTTCGTCTCGAAGAAAATGAGCGTTTTCTTATCGTGGGAAGTTTCGGAATC
CGTGTTGTGGCCGGCGAGGTAACAGTAGCCGGAGCCGCTCTCCGACCATCAGACTGCGTTCATTACGTCCACGCA
CCTCATTGCCATTCTTTACCTGTCCTCCGTACGGCGGAAAACACGAGCCTCGAGCTTCACAATCACCCCGAGGCC
AAACCGCTGAGACTGCTGGGCAAACTATCGCCACTGTTCCAAAATATATGGAACGATTCGCCTCCGGAGACCACG
GAAAAACGTCCTCAAGGACCGACAACCTTTCAAATTCTTGGCGATTCGGAAGATGCCCCAAACGGTTCTATTGTA
CAGGAGCTCGTGTCTCCCCCCAAATGGAACAAGAAGTTGGCATCCATCGTGGAGTCTGTATCTGGACGTCAGCCG
CCCTCAATCGTCGTTTGTGGCCCCAAGTCGTCGGGGAAGTCGACCTTCTCGAGGTTGTTGACAAACCGCCTATTG
GTGACTGCAAACGCTGAAACGTCGGGCTCGACCCGATCAATGGCAACGGGCGTGGCGGTTCTCGACCTCGACCCT
GGACAGCCAGAGTATGCTCCGCCAGGCACCGTGTCGCTTGTCTACGTCACCCAGCCCAATCTCGGCGTGCCCTTT
ACGCACCCGAGCCTCCACGATGGAGCATTTCAGGTTCTCAGATGCCATTCGCTGGCCTCGGTCAACCCGGCCTCG
ACAACTGACCTGCATCTAGAGTGCGCCCTGGACCTGTACGATTACTATCGCCACAGACTCCGCAACTGCCCTCTC
ATCATCAACACTCCCGGATGGGTTCTGAGCTTAGGTTTGGAGCTTCTAGTAGAGGTCATTACCAAGGTACGTCCC
GCCGAAGTCGTCTACATGTCGGAGGACGGGCCGACGGAGACGGTGGATGCTCTGCAAGGAGCCACCAAGAACAAC
TTTACTTCACTGCCGTCACAACCGTCCGAGTTCAAATCTCGAACCGCCGCACAATATCGAGAAATGCAAGCCATG
TCCTACTTCCATTCCGTATGCGACGACGGATCTGGGGGCCCAAAAAGATTGAGCTGGTCGCCGCACGCTCTCTCG
TCTGTACGCCCGCTCGTGGTGCGCTATTCAGGCAAAGGCCGCGGATTTCTTGGCATACTGCGATACGACTATCAA
CTGGCGCCAGAACTCATAGCCGAGGCGATCAACGGCGTGGTTCTTGCCATAGTCGAGATCGAGCAGCCGCAGGCG
TTCCGTTGCCTCTTTCAAGACATGGCGCCTGACGTGACGGCCAAGGACGGCGACTCTCCCTGCAGTCCATTGATC
TCCTGGTCACCCGAGGGCATACCGTTCATTTCGAACCCCGACGACGTGACGCTGGATCCGCGGCATTCACGCACG
CTCGGGCTGGCGCTGGTGCGCGGTGTCGACACGGCGAACAAGTCACTGCAGATCCTCACCCCGACCCCGTTGAGC
AGCATCCGTGGAGCAACGTCTCGAGGCAGCAGCGTCGTCCTCGTACACGGCAGATTCGACCCCCCCACCTGGTCG
TATACGGAGCACCTGCAGGAGCTCGCCGTCGAGGATGTCGCACAAGAGCAAGGGCCCGAGGTGACGGAAGAGGAC
ACCAGCGACGAGGAAGGAGATGCCACAGCGGACGACGCGTCGCAACGGGAAGGTGGTACGGCCGTGCCGTGGGTA
GAGACCCTAAAGGGCAATCAGAAGCGCCCTGTCGGGTCGAAAGTATGGAGGGTTCGGAGAGACCTTGGCCGCCAC
ACCGTCGGCTAA
Transcript >Hirsu2|3322
ATGCCGTCTTCGCCTCATAAGAGACGCAAAGTGGAAGGCTCTGACACTCCGCAGTCAGCAGTGAGTGCTATCAGC
GCCCTGGCGGCCCGGCGCCGACTCAATGCTTCTGGAGCGGCCGACACCAGCTCTTCGCCGCCAATCTCGGGCCCC
TCGCGAACCGTCGCCGCCCCTTCAAACCCGTTCAGTCCCCTGCAGGACCGCCAGCAAAAGCGAGCGTCGGTGACG
GCGCCAAGCAAGGCTACGCCCGGCCAGGGCTCTGTCAGAAGCCGAAGGCTGCGCGAGCGAGCGCCTGCGGCGGAG
TCTGTGAAAGGATCGTCCAAGTCAGAATCTCGACCTGTGACGTACTCATCTTTTCCCCTATCGAAGCTCAACTAT
TGCATCAAGGGCGATGTGGCAGAACTTCGTCTCGAAGAAAATGAGCGTTTTCTTATCGTGGGAAGTTTCGGAATC
CGTGTTGTGGCCGGCGAGGTAACAGTAGCCGGAGCCGCTCTCCGACCATCAGACTGCGTTCATTACGTCCACGCA
CCTCATTGCCATTCTTTACCTGTCCTCCGTACGGCGGAAAACACGAGCCTCGAGCTTCACAATCACCCCGAGGCC
AAACCGCTGAGACTGCTGGGCAAACTATCGCCACTGTTCCAAAATATATGGAACGATTCGCCTCCGGAGACCACG
GAAAAACGTCCTCAAGGACCGACAACCTTTCAAATTCTTGGCGATTCGGAAGATGCCCCAAACGGTTCTATTGTA
CAGGAGCTCGTGTCTCCCCCCAAATGGAACAAGAAGTTGGCATCCATCGTGGAGTCTGTATCTGGACGTCAGCCG
CCCTCAATCGTCGTTTGTGGCCCCAAGTCGTCGGGGAAGTCGACCTTCTCGAGGTTGTTGACAAACCGCCTATTG
GTGACTGCAAACGCTGAAACGTCGGGCTCGACCCGATCAATGGCAACGGGCGTGGCGGTTCTCGACCTCGACCCT
GGACAGCCAGAGTATGCTCCGCCAGGCACCGTGTCGCTTGTCTACGTCACCCAGCCCAATCTCGGCGTGCCCTTT
ACGCACCCGAGCCTCCACGATGGAGCATTTCAGGTTCTCAGATGCCATTCGCTGGCCTCGGTCAACCCGGCCTCG
ACAACTGACCTGCATCTAGAGTGCGCCCTGGACCTGTACGATTACTATCGCCACAGACTCCGCAACTGCCCTCTC
ATCATCAACACTCCCGGATGGGTTCTGAGCTTAGGTTTGGAGCTTCTAGTAGAGGTCATTACCAAGGTACGTCCC
GCCGAAGTCGTCTACATGTCGGAGGACGGGCCGACGGAGACGGTGGATGCTCTGCAAGGAGCCACCAAGAACAAC
TTTACTTCACTGCCGTCACAACCGTCCGAGTTCAAATCTCGAACCGCCGCACAATATCGAGAAATGCAAGCCATG
TCCTACTTCCATTCCGTATGCGACGACGGATCTGGGGGCCCAAAAAGATTGAGCTGGTCGCCGCACGCTCTCTCG
TCTGTACGCCCGCTCGTGGTGCGCTATTCAGGCAAAGGCCGCGGATTTCTTGGCATACTGCGATACGACTATCAA
CTGGCGCCAGAACTCATAGCCGAGGCGATCAACGGCGTGGTTCTTGCCATAGTCGAGATCGAGCAGCCGCAGGCG
TTCCGTTGCCTCTTTCAAGACATGGCGCCTGACGTGACGGCCAAGGACGGCGACTCTCCCTGCAGTCCATTGATC
TCCTGGTCACCCGAGGGCATACCGTTCATTTCGAACCCCGACGACGTGACGCTGGATCCGCGGCATTCACGCACG
CTCGGGCTGGCGCTGGTGCGCGGTGTCGACACGGCGAACAAGTCACTGCAGATCCTCACCCCGACCCCGTTGAGC
AGCATCCGTGGAGCAACGTCTCGAGGCAGCAGCGTCGTCCTCGTACACGGCAGATTCGACCCCCCCACCTGGTCG
TATACGGAGCACCTGCAGGAGCTCGCCGTCGAGGATGTCGCACAAGAGCAAGGGCCCGAGGTGACGGAAGAGGAC
ACCAGCGACGAGGAAGGAGATGCCACAGCGGACGACGCGTCGCAACGGGAAGGTGGTACGGCCGTGCCGTGGGTA
GAGACCCTAAAGGGCAATCAGAAGCGCCCTGTCGGGTCGAAAGTATGGAGGGTTCGGAGAGACCTTGGCCGCCAC
ACCGTCGGCTAA
Gene >Hirsu2|3322
ATGCCGTCTTCGCCTCATAAGAGACGCAAAGTGGAAGGCTCTGACACTCCGCAGTGTATGTAAGTCGACTGCTCG
TCCATCAGCTCATCTCCATCGTTGACAATAGAGCGCTTCAGCAGCAGTGAGTGCTATCAGCGCCCTGGCGGCCCG
GCGCCGACTCAATGCTTCTGGAGCGGCCGACACCAGCTCTTCGCCGCCAATCTCGGGCCCCTCGCGAACCGTCGC
CGCCCCTTCAAACCCGTTCAGTCCCCTGCAGGACCGCCAGCAAAAGCGAGCGTCGGTGACGGCGCCAAGCAAGGC
TACGCCCGGCCAGGGCTCTGTCAGAAGCCGAAGGCTGCGCGAGCGAGCGCCTGCGTAGGTTTCCTCGCTTGGCTT
GTTCAATCCTATCCCACACTGGTCTAACCAATCTTGCTAGGGCGGAGTCTGTGAAAGGATCGTCCAAGTCAGAAT
CTCGACCTGTGACGTACTCATCTTTTCCCCTATCGAAGCTCAACTATTGCATCAAGGGCGATGTGGCAGAACTTC
GTCTCGAAGAAAATGAGGTAAATCACCTGCAAACCCCTTCATAGATAGATGGGACAGCATTCTTACTTTACCTTT
CTCAGCGTTTTCTTATCGTGGGAAGTTTCGGAATCCGTGTTGTGGCCGGCGAGGTAACAGTAGCCGGAGCCGCTC
TCCGACCATCAGACTGCGTTCATTACGTCCACGCACCTCATTGCCATTCTTTACCTGTCCTCCGTACGGCGGAAA
ACACGAGCCTCGAGCTTCACAATCACCCCGAGGCCAAACCGCTGAGACTGCTGGGCAAACTATCGCCACTGTTCC
AAAATATATGGAACGATTCGCCTCCGGAGACCACGGAAAAACGTCCTCAAGGACCGACAACCTTTCAAATTGTCA
GTGAGTGCTCGCTCCTGACCGTTTGTTCGAAAGCACTAAATGAATTGTAGCTTGGCGATTCGGAAGATGCCCCAA
ACGGTTCTATTGTACAGGAGCTCGTGTCTCCCCCCAAATGGAACAAGAAGTTGGCATCCATCGTGGAGTCTGTAT
CTGGACGTCAGCCGCCCTCAATCGTCGTTTGTGGCCCCAAGTCGTCGGGGAAGTCGACCTTCTCGAGGTTGTTGA
CAAACCGCCTATTGGTGACTGCAAACGCTGAAACGTCGGGCTCGACCCGATCAATGGCAACGGGCGTGGCGGTTC
TCGACCTCGACCCTGGACAGCCAGAGTATGCTCCGCCAGGCACCGTGTCGCTTGTCTACGTCACCCAGCCCAATC
TCGGCGTGCCCTTTACGCACCCGAGCCTCCACGATGGAGCATTTCAGGTTCTCAGATGCCATTCGCTGGCCTCGG
TCAACCCGGCCTCGACAACTGACCTGCATCTAGAGTGCGCCCTGGACCTGTACGATTACTATCGCCACAGACTCC
GCAACTGCCCTCTCATCATCAACACTCCCGGATGGGTTCTGAGCTTAGGTTTGGAGCTTCTAGTAGAGGTCATTA
CCAAGGTACGTCCCGCCGAAGTCGTCTACATGTCGGAGGACGGGCCGACGGAGACGGTGGATGCTCTGCAAGGAG
CCACCAAGAACAACTTTACTTCACTGCCGTCACAACCGTCCGAGTTCAAATCTCGAACCGCCGCACAATATCGAG
AAATGCAAGCCATGTCCTACTTCCATTCCGTATGCGACGACGGATCTGGGGGCCCAAAAAGATTGAGCTGGTCGC
CGCACGCTCTCTCGTCTGTACGCCCGCTCGTGGTGCGCTATTCAGGCAAAGGCCGCGGATTTCTTGGCATACTGC
GATACGACTATCAACTGGCGCCAGAACTCATAGCCGAGGCGATCAACGGCGTGGTTCTTGCCATAGTCGAGATCG
AGCAGCCGCAGGCGTTCCGTTGCCTCTTTCAAGACATGGCGCCTGACGTGACGGCCAAGGACGGCGACTCTCCCT
GCAGTCCATTGATCTCCTGGTCACCCGAGGGCATACCGTTCATTTCGAACCCCGACGACGTGACGCTGGATCCGC
GGCATTCACGCACGCTCGGGCTGGCGCTGGTGCGCGGTGTCGACACGGCGAACAAGTCACTGCAGATCCTCACCC
CGACCCCGTTGAGCAGCATCCGTGGAGCAACGTCTCGAGGCAGCAGCGTCGTCCTCGTACACGGCAGATTCGACC
CCCCCACCTGGTCGTATACGGAGCACCTGCAGGAGCTCGCCGTCGAGGATGTCGCACAAGAGCAAGGGCCCGAGG
TGACGGAAGAGGACACCAGCGACGAGGAAGGAGATGCCACAGCGGACGACGCGTCGCAACGGGAAGGTGGTACGG
CCGTGCCGTGGGTAGAGACCCTAAAGGGCAATCAGAAGCGCCCTGTCGGGTCGAAAGTATGGAGGGTTCGGAGAG
ACCTTGGCCGCCACACCGTCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail