Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3320
Gene name
LocationContig_1859:412..2267
Strand+
Gene length (bp)1855
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06814 Lung_7-TM_R Lung seven transmembrane receptor 8.8E-70 122 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 4 463 3.0E-86
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 4 463 4.0E-86
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 9 429 7.0E-65
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 2 452 2.0E-64
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 9 410 7.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 4 463 3.0E-86
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 4 463 4.0E-86
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 9 429 7.0E-65
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 2 452 2.0E-64
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 9 410 7.0E-32
sp|Q28EW0|TM87A_XENTR Transmembrane protein 87A OS=Xenopus tropicalis GN=tmem87a PE=2 SV=1 141 482 6.0E-29
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 115 443 3.0E-23
sp|Q96K49|TM87B_HUMAN Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1 150 443 2.0E-22
sp|Q8NBN3|TM87A_HUMAN Transmembrane protein 87A OS=Homo sapiens GN=TMEM87A PE=1 SV=3 140 416 7.0E-19
sp|Q8BXN9|TM87A_MOUSE Transmembrane protein 87A OS=Mus musculus GN=Tmem87a PE=1 SV=1 140 416 1.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 161 183 22
2 195 214 19
3 229 251 22
4 272 291 19
5 301 323 22
6 344 366 22
7 381 403 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3320
MDQSEPNRQYCSGMYSRTTWGGPVEPFILVKFLNSSVPEGSDPITSLIIFEWTDKKLVGVPDPNFPGMQLEICHE
QSVQKGRCNNTDVGQFIISPNATESSNALIVTKAIHLKQSSPIRYAIKTTGYYCVVTDVFTAKTYSLVTEFRNAY
GELPATQIPKLPFYGGMSILYALVCVFWGFLYYQHRHDILAVQNFITAILMFLVVEMLMTWGFYDYQNRLGSNAG
SKVFLIVVGILNAARNSFSFFLLLIVCMGYGVVKPTLGRTMLHVRWLAAAHFVFGLVYAITSLLISPESAGPFVL
LIVLPLAGTLTAFYVWTLNSLSFTLKDLRERKQHAKEAMYKKLWWAILVSVLVIFGFFFFNSFTFASVNDPDFVP
FHWKTRWFVLDGWLNIVYFADVVWIAYIWRPTANNRRFAMSDEIAQDDDGNFEIGDIGVLDDSDDEEEARGGKHQ
VHPPPTTGFTRAEPVLGTQRRSEERSFVRQSLERETVFAIGEEGD*
Coding >Hirsu2|3320
ATGGACCAGTCAGAGCCCAATCGCCAATATTGCTCCGGCATGTACAGTCGGACCACATGGGGAGGGCCAGTCGAG
CCCTTTATCCTCGTCAAGTTTCTCAACTCCAGTGTCCCCGAGGGCAGCGATCCCATAACGAGCTTGATCATCTTT
GAATGGACCGACAAGAAGTTGGTCGGCGTCCCGGATCCAAATTTCCCCGGCATGCAACTCGAGATCTGCCACGAG
CAATCCGTCCAGAAAGGTCGCTGCAATAACACAGATGTTGGCCAATTCATAATTTCCCCCAACGCTACCGAAAGT
TCCAATGCCCTGATCGTCACCAAAGCGATCCACCTCAAGCAATCCAGCCCCATCCGCTACGCCATAAAAACAACC
GGCTATTACTGCGTTGTCACCGATGTCTTCACTGCAAAAACCTACAGCCTGGTGACGGAGTTCCGGAACGCCTAC
GGCGAACTTCCGGCAACACAAATTCCCAAGCTGCCCTTTTATGGCGGCATGTCTATTCTCTACGCCCTCGTCTGT
GTCTTCTGGGGTTTCCTCTATTATCAGCATCGCCACGACATTTTGGCTGTGCAAAATTTCATTACCGCTATCCTG
ATGTTCCTTGTGGTGGAAATGCTCATGACCTGGGGCTTCTATGACTATCAAAACCGCCTTGGATCGAACGCGGGT
TCGAAAGTCTTTCTCATTGTCGTTGGCATACTCAATGCGGCGCGAAACTCATTCTCTTTCTTCCTCCTGCTCATT
GTCTGTATGGGCTACGGCGTTGTAAAGCCAACCCTCGGCCGGACTATGTTACACGTCCGCTGGCTCGCAGCAGCA
CATTTCGTTTTCGGGCTCGTCTACGCTATAACCAGTCTTCTCATCTCGCCTGAAAGTGCAGGACCCTTTGTTCTG
CTGATTGTGCTCCCCTTGGCCGGAACGCTGACCGCCTTTTATGTTTGGACACTCAACTCCCTCAGCTTCACGCTC
AAGGATCTGAGAGAGCGGAAGCAGCACGCAAAGGAGGCCATGTATAAGAAGCTCTGGTGGGCCATACTCGTTAGC
GTCCTGGTCATTTTCGGCTTCTTCTTCTTCAACAGCTTCACTTTTGCCTCGGTGAACGACCCGGACTTCGTTCCA
TTCCACTGGAAAACCAGATGGTTCGTCCTGGACGGCTGGCTGAACATTGTCTATTTCGCCGATGTGGTCTGGATC
GCCTACATCTGGCGCCCGACAGCGAACAACCGGCGATTCGCTATGAGCGATGAAATTGCGCAGGACGACGATGGA
AACTTTGAGATTGGGGACATTGGCGTCCTCGACGACTCGGATGACGAGGAGGAAGCTCGGGGCGGGAAACACCAG
GTCCACCCGCCTCCCACCACGGGCTTTACTCGCGCAGAGCCGGTGCTCGGCACCCAGCGGCGATCTGAGGAGCGA
AGCTTCGTGCGGCAGTCACTGGAGAGAGAGACGGTTTTTGCCATCGGCGAAGAGGGAGACTGA
Transcript >Hirsu2|3320
ATGGACCAGTCAGAGCCCAATCGCCAATATTGCTCCGGCATGTACAGTCGGACCACATGGGGAGGGCCAGTCGAG
CCCTTTATCCTCGTCAAGTTTCTCAACTCCAGTGTCCCCGAGGGCAGCGATCCCATAACGAGCTTGATCATCTTT
GAATGGACCGACAAGAAGTTGGTCGGCGTCCCGGATCCAAATTTCCCCGGCATGCAACTCGAGATCTGCCACGAG
CAATCCGTCCAGAAAGGTCGCTGCAATAACACAGATGTTGGCCAATTCATAATTTCCCCCAACGCTACCGAAAGT
TCCAATGCCCTGATCGTCACCAAAGCGATCCACCTCAAGCAATCCAGCCCCATCCGCTACGCCATAAAAACAACC
GGCTATTACTGCGTTGTCACCGATGTCTTCACTGCAAAAACCTACAGCCTGGTGACGGAGTTCCGGAACGCCTAC
GGCGAACTTCCGGCAACACAAATTCCCAAGCTGCCCTTTTATGGCGGCATGTCTATTCTCTACGCCCTCGTCTGT
GTCTTCTGGGGTTTCCTCTATTATCAGCATCGCCACGACATTTTGGCTGTGCAAAATTTCATTACCGCTATCCTG
ATGTTCCTTGTGGTGGAAATGCTCATGACCTGGGGCTTCTATGACTATCAAAACCGCCTTGGATCGAACGCGGGT
TCGAAAGTCTTTCTCATTGTCGTTGGCATACTCAATGCGGCGCGAAACTCATTCTCTTTCTTCCTCCTGCTCATT
GTCTGTATGGGCTACGGCGTTGTAAAGCCAACCCTCGGCCGGACTATGTTACACGTCCGCTGGCTCGCAGCAGCA
CATTTCGTTTTCGGGCTCGTCTACGCTATAACCAGTCTTCTCATCTCGCCTGAAAGTGCAGGACCCTTTGTTCTG
CTGATTGTGCTCCCCTTGGCCGGAACGCTGACCGCCTTTTATGTTTGGACACTCAACTCCCTCAGCTTCACGCTC
AAGGATCTGAGAGAGCGGAAGCAGCACGCAAAGGAGGCCATGTATAAGAAGCTCTGGTGGGCCATACTCGTTAGC
GTCCTGGTCATTTTCGGCTTCTTCTTCTTCAACAGCTTCACTTTTGCCTCGGTGAACGACCCGGACTTCGTTCCA
TTCCACTGGAAAACCAGATGGTTCGTCCTGGACGGCTGGCTGAACATTGTCTATTTCGCCGATGTGGTCTGGATC
GCCTACATCTGGCGCCCGACAGCGAACAACCGGCGATTCGCTATGAGCGATGAAATTGCGCAGGACGACGATGGA
AACTTTGAGATTGGGGACATTGGCGTCCTCGACGACTCGGATGACGAGGAGGAAGCTCGGGGCGGGAAACACCAG
GTCCACCCGCCTCCCACCACGGGCTTTACTCGCGCAGAGCCGGTGCTCGGCACCCAGCGGCGATCTGAGGAGCGA
AGCTTCGTGCGGCAGTCACTGGAGAGAGAGACGGTTTTTGCCATCGGCGAAGAGGGAGACTGA
Gene >Hirsu2|3320
ATGGTATGCGCCTTACCTGACCTCCTTCGTCGTGTAGTTACAAGCTGACGAATTCGCATTGTAGGACCAGTCAGA
GCCCAATCGCCAATATTGCTCCGGTCTACTCCCCTGAAGCAGACGAAGCAGACGCGGCTTCTCTACGACGCCTCG
GTACTGACTGTTGTGGCAGGCATGTACAGTCGGACCACATGGGGAGGGCCAGTCGAGCCCTTTATCCTCGTCAAG
TTTCTCAACTCCAGTGTCCCCGAGGGCAGCGATCCCATAACGAGCTTGATCATCTTTGAATGGACCGACAAGAAG
TTGGTCGGCGTCCCGGATCCAAATTTCCCCGGCATGGTAAGGTTCTCTCTCCTTTGAGACATTCGAGACGCAACC
TCCGACTCAGTGTATACCACAGCAACTCGAGATCTGCCACGAGCAATCCGTCCAGAAAGGTCGCTGCAATAACAC
AGATGTTGGCCAATTCATAATTTCCCCCAACGCTACCGAAAGTTCCAATGCCCTGATCGTCACCAAAGCGATCCA
CCTCAAGCAATCCAGCCCCATCCGCTACGCCATAAAAACAACCGGCTATTACTGCGTTGTCACCGATGTCTTCAC
TGCAAAAACCTACAGCCTGGTGACGGAGTTCCGGAACGCCTACGGCGAACTTCCGGCAACACAAATTCCCAAGCT
GCCCTTTTATGGCGGCATGTCTATTCTCTACGCCCTCGTCTGTGTCTTCTGGGGTTTCCTCTATTATCAGCATCG
CCACGACATTTGTGAGGCGGCGTCCACCCCAATCATTCGTCTGTTTCGCACCGCTGACCAAGGAATGACAGTGGC
TGTGCAAAATTTCATTACCGCTATCCTGATGTTCCTTGTGGTGGAAATGCTCATGACCTGGGGCTTCTATGGTAC
GTCGTTCTCCCCCGTTCGCACTCTCTCGGATCTTTTCCTCACGCTGACGCTGCTCCCAGACTATCAAAACCGCCT
TGGATCGAACGCGGGTTCGAAAGTCTTTCTCATTGTCGTTGGCATACTCAATGCGGCGCGAAACTCATTCTCTTT
CTTCCTCCTGCTCATTGTCTGTATGGGCTACGGCGTTGTAAAGCCAACCCTCGGCCGGACTATGTTACACGTCCG
CTGGCTCGCAGCAGCACATTTCGTTTTCGGGCTCGTCTACGCTATAACCAGTCTTCTCATCTCGCCTGAAAGTGC
AGGTAAGCAGAGCCCCGCCAGCTTGAAGAGGCGTCAGGTGCTTACCATGACAGGACCCTTTGTTCTGCTGATTGT
GCTCCCCTTGGCCGGAACGCTGACCGCCTTTTATGTTTGGACACTCAACTCCCTCAGCTTCACGCTCAAGGATCT
GAGAGAGCGGAAGCAGCACGCAAAGGAGGCCATGTATAAGAAGCTCTGGTGGGCCATACTCGTTAGCGTCCTGGT
CATTTTCGGCTTCTTCTTCTTCAACAGCTTCACTTTTGCCTCGGTGAACGACCCGGACTTCGTTCCATTCCACTG
GAAAACCAGATGGTTCGTCCTGGACGGCTGGCTGAACATTGTCTATTTCGCCGATGTGGTCTGGATCGCCTACAT
CTGGCGCCCGACAGCGAACAACCGGCGATTCGCTATGAGCGATGAAATTGCGCAGGACGACGATGGAAACTTTGA
GATTGGGGACATTGGCGTCCTCGACGACTCGGATGACGAGGAGGAAGCTCGGGGCGGGAAACACCAGGTCCACCC
GCCTCCCACCACGGGCTTTACTCGCGCAGAGCCGGTGCTCGGCACCCAGCGGCGATCTGAGGAGCGAAGCTTCGT
GCGGCAGTCACTGGAGAGAGAGACGGTTTTTGCCATCGGCGAAGAGGGAGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail