Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3315
Gene name
LocationContig_1856:490..1391
Strand-
Gene length (bp)901
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00838 TCTP Translationally controlled tumour protein 1.6E-69 1 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYV5|TCTP_NEUCR Translationally-controlled tumor protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06464 PE=3 SV=1 1 170 6.0E-84
sp|Q4IJT5|TCTP_GIBZE Translationally-controlled tumor protein homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_02523 PE=3 SV=1 1 170 2.0E-80
sp|Q6FKB6|TCTP_CANGA Translationally-controlled tumor protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0L12870g PE=3 SV=1 1 170 9.0E-77
sp|P35691|TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1 1 170 1.0E-74
sp|Q6CTH3|TCTP_KLULA Translationally-controlled tumor protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C12716g PE=3 SV=1 1 170 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYV5|TCTP_NEUCR Translationally-controlled tumor protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06464 PE=3 SV=1 1 170 6.0E-84
sp|Q4IJT5|TCTP_GIBZE Translationally-controlled tumor protein homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_02523 PE=3 SV=1 1 170 2.0E-80
sp|Q6FKB6|TCTP_CANGA Translationally-controlled tumor protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0L12870g PE=3 SV=1 1 170 9.0E-77
sp|P35691|TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1 1 170 1.0E-74
sp|Q6CTH3|TCTP_KLULA Translationally-controlled tumor protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C12716g PE=3 SV=1 1 170 1.0E-73
sp|Q5A860|TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1 1 170 5.0E-73
sp|Q6BP09|TCTP_DEBHA Translationally-controlled tumor protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2E17468g PE=3 SV=1 1 170 4.0E-70
sp|Q6C4G1|TCTP_YARLI Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E27071g PE=3 SV=1 1 170 2.0E-67
sp|P0CR82|TCTP_CRYNJ Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNM01460 PE=3 SV=1 1 170 6.0E-66
sp|P0CR83|TCTP_CRYNB Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBM1320 PE=3 SV=1 1 170 6.0E-66
sp|Q10344|TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=p23fy PE=1 SV=1 1 169 6.0E-60
sp|Q4PF30|TCTP_USTMA Translationally-controlled tumor protein homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12131 PE=3 SV=2 1 170 1.0E-57
sp|Q2UR29|TCTP_ASPOR Translationally-controlled tumor protein homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000996 PE=3 SV=1 1 170 4.0E-47
sp|Q9DGK4|TCTP_DANRE Translationally-controlled tumor protein homolog OS=Danio rerio GN=tpt1 PE=2 SV=1 1 165 5.0E-45
sp|Q98SJ7|TCTP_LABRO Translationally-controlled tumor protein homolog OS=Labeo rohita GN=tpt1 PE=2 SV=1 1 165 2.0E-44
sp|P91800|TCTP_SCHJA Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1 1 169 4.0E-42
sp|Q9M5G3|TCTP_HORVU Translationally-controlled tumor protein homolog OS=Hordeum vulgare GN=TCTP PE=2 SV=2 1 170 3.0E-40
sp|Q5BFN9|TCTP_EMENI Translationally-controlled tumor protein homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0641 PE=1 SV=1 1 170 2.0E-39
sp|Q5E984|TCTP_BOVIN Translationally-controlled tumor protein OS=Bos taurus GN=TPT1 PE=2 SV=1 1 165 3.0E-39
sp|P13693|TCTP_HUMAN Translationally-controlled tumor protein OS=Homo sapiens GN=TPT1 PE=1 SV=1 1 165 5.0E-39
sp|A5A6K2|TCTP_PANTR Translationally-controlled tumor protein OS=Pan troglodytes GN=TPT1 PE=2 SV=1 1 165 5.0E-39
sp|Q4WRB8|TCTP_ASPFU Translationally-controlled tumor protein homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G16840 PE=3 SV=1 1 170 5.0E-39
sp|P61288|TCTP_PIG Translationally-controlled tumor protein OS=Sus scrofa GN=TPT1 PE=2 SV=1 1 165 5.0E-39
sp|Q8H6A5|TCTP_MAIZE Translationally-controlled tumor protein homolog OS=Zea mays GN=TCTP PE=2 SV=1 1 170 3.0E-38
sp|P43347|TCTP_CHICK Translationally-controlled tumor protein homolog OS=Gallus gallus GN=TPT1 PE=2 SV=1 1 165 5.0E-38
sp|P43348|TCTP_RABIT Translationally-controlled tumor protein OS=Oryctolagus cuniculus GN=TPT1 PE=2 SV=2 1 165 5.0E-38
sp|U3EQ60|TCTP_MICFL Translationally-controlled tumor protein homolog OS=Micrurus fulvius PE=2 SV=1 1 165 1.0E-37
sp|Q6XSH4|TCTP_LATJA Translationally-controlled tumor protein homolog OS=Lateolabrax japonicus GN=tpt1 PE=2 SV=1 1 165 4.0E-37
sp|Q6DUX3|TCTP_SOLLC Translationally-controlled tumor protein homolog OS=Solanum lycopersicum GN=TCTP PE=2 SV=1 1 170 4.0E-37
sp|Q7ZYF2|TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis GN=tpt1 PE=1 SV=1 1 165 8.0E-37
sp|Q5J907|TCTP_ELAGV Translationally-controlled tumor protein homolog OS=Elaeis guineensis var. tenera GN=TCTP PE=2 SV=1 1 170 1.0E-36
sp|P63028|TCTP_MOUSE Translationally-controlled tumor protein OS=Mus musculus GN=Tpt1 PE=1 SV=1 1 165 2.0E-36
sp|P63029|TCTP_RAT Translationally-controlled tumor protein OS=Rattus norvegicus GN=Tpt1 PE=1 SV=1 1 165 2.0E-36
sp|T1DKS4|TCTP_CROHD Translationally-controlled tumor protein homolog OS=Crotalus horridus PE=2 SV=1 1 165 5.0E-36
sp|J3SFJ3|TCTP_CROAD Translationally-controlled tumor protein homolog OS=Crotalus adamanteus PE=2 SV=1 1 165 5.0E-36
sp|Q66JC5|TCTP_XENTR Translationally-controlled tumor protein homolog OS=Xenopus tropicalis GN=tpt1 PE=2 SV=1 1 170 7.0E-36
sp|O03992|TCTP_FRAAN Translationally-controlled tumor protein homolog OS=Fragaria ananassa GN=TCTP PE=2 SV=1 1 170 1.0E-35
sp|Q9ZSW9|TCTP_HEVBR Translationally-controlled tumor protein homolog OS=Hevea brasiliensis GN=TCTP PE=2 SV=1 1 170 2.0E-35
sp|P31265|TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana GN=TCTP1 PE=1 SV=2 1 170 4.0E-35
sp|Q95VY2|TCTP_BRABE Translationally-controlled tumor protein homolog OS=Branchiostoma belcheri PE=2 SV=1 1 169 7.0E-35
sp|Q9M5I8|TCTP_CUCME Translationally-controlled tumor protein homolog OS=Cucumis melo GN=TCTP PE=2 SV=1 1 170 8.0E-35
sp|P28014|TCTP_MEDSA Translationally-controlled tumor protein homolog OS=Medicago sativa GN=TCTP PE=2 SV=2 1 170 9.0E-35
sp|P43349|TCTP_SOLTU Translationally-controlled tumor protein homolog OS=Solanum tuberosum GN=TCTP PE=2 SV=2 1 170 4.0E-34
sp|Q2PS27|TCTP_CUCMA Translationally-controlled tumor protein homolog OS=Cucurbita maxima GN=TCTP PE=2 SV=1 1 170 5.0E-34
sp|P50906|TCTP_PEA Translationally-controlled tumor protein homolog OS=Pisum sativum GN=TCTP PE=2 SV=2 1 170 7.0E-34
sp|Q202I6|TCTP_SCOMX Translationally-controlled tumor protein homolog OS=Scophthalmus maximus GN=tpt1 PE=2 SV=1 1 165 9.0E-34
sp|Q1HR79|TCTP_AEDAE Translationally-controlled tumor protein homolog OS=Aedes aegypti GN=Tctp PE=2 SV=1 1 169 1.0E-33
sp|Q944W6|TCTP_BRAOL Translationally-controlled tumor protein homolog OS=Brassica oleracea GN=TCTP PE=2 SV=1 1 170 1.0E-33
sp|Q6XIN1|TCTP_DROYA Translationally-controlled tumor protein homolog OS=Drosophila yakuba GN=Tctp PE=2 SV=1 1 170 2.0E-33
sp|Q944T2|TCTP_SOYBN Translationally-controlled tumor protein homolog OS=Glycine max GN=TCTP PE=2 SV=1 1 170 2.0E-33
sp|G3LU44|TCTP_LOXIN Translationally-controlled tumor protein homolog OS=Loxosceles intermedia PE=2 SV=1 1 170 2.0E-33
sp|Q95WA2|TCTP_SCHMA Translationally-controlled tumor protein homolog (Fragment) OS=Schistosoma mansoni GN=TCTP PE=2 SV=1 1 166 6.0E-33
sp|Q9ZRX0|TCTP_PSEMZ Translationally-controlled tumor protein homolog OS=Pseudotsuga menziesii GN=TCTP PE=2 SV=1 1 170 7.0E-33
sp|Q9VGS2|TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster GN=Tctp PE=1 SV=1 1 170 1.0E-32
sp|Q293Y0|TCTP_DROPS Translationally-controlled tumor protein homolog OS=Drosophila pseudoobscura pseudoobscura GN=Tctp PE=3 SV=1 1 170 1.0E-32
sp|Q5MIP6|TCTP_AEDAL Translationally-controlled tumor protein homolog OS=Aedes albopictus GN=Tctp PE=2 SV=1 1 169 2.0E-32
sp|Q8LRM8|TCTP_WHEAT Translationally-controlled tumor protein homolog OS=Triticum aestivum GN=TCTP PE=2 SV=1 1 170 6.0E-32
sp|P35681|TCTP_ORYSJ Translationally-controlled tumor protein homolog OS=Oryza sativa subsp. japonica GN=TCTP PE=1 SV=1 1 170 1.0E-31
sp|Q9XHL7|TCTP_TOBAC Translationally-controlled tumor protein homolog OS=Nicotiana tabacum GN=TCTP PE=2 SV=1 1 170 3.0E-31
sp|Q75VN3|TCTP_BOMMO Translationally-controlled tumor protein homolog OS=Bombyx mori GN=Tctp PE=2 SV=1 1 169 3.0E-31
sp|Q7QCK2|TCTP_ANOGA Translationally-controlled tumor protein homolog OS=Anopheles gambiae GN=Tctp PE=3 SV=2 1 169 4.0E-31
sp|Q60FS1|TCTP_PLUXY Translationally-controlled tumor protein homolog OS=Plutella xylostella GN=Tctp PE=2 SV=1 1 169 5.0E-31
sp|O18477|TCTP_LUMRU Translationally-controlled tumor protein homolog OS=Lumbricus rubellus GN=TCTP PE=2 SV=1 1 170 2.0E-30
sp|Q5MGM6|TCTP_LONON Translationally-controlled tumor protein homolog OS=Lonomia obliqua GN=Tctp PE=2 SV=1 1 169 3.0E-30
sp|Q54RX6|TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum GN=DDB_G0282853 PE=3 SV=1 1 169 1.0E-29
sp|M5B4R7|TCTP_GRARO Translationally-controlled tumor protein homolog OS=Grammostola rosea PE=2 SV=1 1 170 2.0E-29
sp|Q4PLZ3|TCTP_IXOSC Translationally-controlled tumor protein homolog OS=Ixodes scapularis GN=Tctp PE=2 SV=1 1 169 1.0E-26
sp|Q962A2|TCTP_WUCBA Translationally-controlled tumor protein homolog OS=Wuchereria bancrofti PE=2 SV=1 1 169 1.0E-22
sp|P90697|TCTP_BRUMA Translationally-controlled tumor protein homolog OS=Brugia malayi PE=2 SV=1 1 169 2.0E-22
sp|Q54RX1|TCTP2_DICDI Translationally-controlled tumor protein homolog 2 OS=Dictyostelium discoideum GN=DDB_G0282861 PE=3 SV=1 1 170 1.0E-20
sp|P84152|TCTP_PLAKN Translationally-controlled tumor protein homolog OS=Plasmodium knowlesi GN=TCTP PE=1 SV=1 1 169 1.0E-20
sp|Q9M9V9|TCTP2_ARATH Translationally controlled tumor protein 2 OS=Arabidopsis thaliana GN=TCTP2 PE=1 SV=1 1 170 3.0E-20
sp|Q8I3Z5|TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=TCTP PE=1 SV=1 1 169 6.0E-20
sp|Q2L875|TCTP_TRIPS Translationally-controlled tumor protein homolog OS=Trichinella pseudospiralis PE=2 SV=1 1 166 2.0E-18
sp|Q4N938|TCTP_THEPA Translationally-controlled tumor protein homolog OS=Theileria parva GN=TCTP PE=3 SV=1 1 169 5.0E-18
sp|Q4XFJ8|TCTP_PLACH Translationally-controlled tumor protein homolog OS=Plasmodium chabaudi GN=TCTP PE=3 SV=1 1 169 2.0E-17
sp|Q4YZC6|TCTP_PLABA Translationally-controlled tumor protein homolog OS=Plasmodium berghei (strain Anka) GN=TCTP PE=3 SV=1 1 169 5.0E-17
sp|Q9XYU2|TCTP_PLAYO Translationally-controlled tumor protein homolog OS=Plasmodium yoelii yoelii GN=TCTP PE=3 SV=2 1 169 8.0E-17
sp|Q622B7|TCTP_CAEBR Translationally-controlled tumor protein homolog OS=Caenorhabditis briggsae GN=tct-1 PE=3 SV=1 1 170 5.0E-16
sp|Q4UGL5|TCTP_THEAN Translationally-controlled tumor protein homolog OS=Theileria annulata GN=TCTP PE=3 SV=1 1 169 1.0E-15
sp|Q93573|TCTP_CAEEL Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans GN=tct-1 PE=1 SV=1 1 170 1.0E-15
sp|Q56UQ5|TPT1L_HUMAN TPT1-like protein OS=Homo sapiens PE=2 SV=2 1 131 1.0E-11
sp|Q9HAU6|TCTP8_HUMAN Putative translationally-controlled tumor protein-like protein TPT1P8 OS=Homo sapiens GN=TPT1P8 PE=5 SV=2 1 120 4.0E-11
sp|Q8I8A2|TCTP_SCHHA Translationally-controlled tumor protein homolog (Fragment) OS=Schistosoma haematobium GN=TCTP PE=2 SV=2 13 149 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3315
MIIYKDILTGDEILSDSYNLKEVDGIVYEADCAMITEEAVNVDTGANASAEGGDEAVEDEAVKVNNIVHSFRLQS
TQFDKKSFLTYLKGYMKAVKAALQEKNASADTITAFEKGAQAYVKDKLLPNFKDLEFYTGETMSPDGLVVLLNYR
EDGVTPYVIVWKHGLTEMKV*
Coding >Hirsu2|3315
ATGATCATCTACAAGGATATCCTTACCGGTGACGAGATCCTCTCCGACTCGTACAATCTCAAGGAGGTCGATGGC
ATCGTCTACGAGGCCGACTGTGCCATGATCACGGAGGAGGCTGTCAACGTCGACACCGGCGCCAACGCCTCGGCC
GAGGGCGGCGACGAGGCCGTCGAGGACGAGGCCGTCAAGGTCAACAACATCGTCCACTCGTTCCGCCTCCAGTCC
ACCCAGTTCGACAAGAAGAGCTTCCTCACCTACCTCAAGGGCTACATGAAGGCCGTCAAGGCCGCCCTCCAGGAG
AAGAATGCCTCGGCCGACACCATCACCGCCTTCGAGAAGGGCGCTCAGGCCTACGTCAAGGATAAGCTGCTACCC
AACTTCAAGGACTTAGAGTTCTACACGGGCGAGACCATGAGCCCCGACGGACTCGTTGTCCTCCTCAATTACCGC
GAGGACGGCGTCACCCCCTACGTCATCGTGTGGAAGCACGGCCTTACGGAGATGAAGGTCTAA
Transcript >Hirsu2|3315
ATGATCATCTACAAGGATATCCTTACCGGTGACGAGATCCTCTCCGACTCGTACAATCTCAAGGAGGTCGATGGC
ATCGTCTACGAGGCCGACTGTGCCATGATCACGGAGGAGGCTGTCAACGTCGACACCGGCGCCAACGCCTCGGCC
GAGGGCGGCGACGAGGCCGTCGAGGACGAGGCCGTCAAGGTCAACAACATCGTCCACTCGTTCCGCCTCCAGTCC
ACCCAGTTCGACAAGAAGAGCTTCCTCACCTACCTCAAGGGCTACATGAAGGCCGTCAAGGCCGCCCTCCAGGAG
AAGAATGCCTCGGCCGACACCATCACCGCCTTCGAGAAGGGCGCTCAGGCCTACGTCAAGGATAAGCTGCTACCC
AACTTCAAGGACTTAGAGTTCTACACGGGCGAGACCATGAGCCCCGACGGACTCGTTGTCCTCCTCAATTACCGC
GAGGACGGCGTCACCCCCTACGTCATCGTGTGGAAGCACGGCCTTACGGAGATGAAGGTCTAA
Gene >Hirsu2|3315
ATGATCATCTACAAGGTGTGTCTCTCCAGCCGCCGACAGCCAGCGCCCGTTTTTTTTCTGCCTGCTCTCTACCCC
GCCTGCGGTCCCCCTCCCCTCTTCGCCTCCAGCCGCTCTCTCGCGCGCGCGCTCTCTCGCATGTCGCCCATCTTT
CCTTGTCGCTGACCGGCACGGCCTCGTGTAGGATATCCTTACCGGTGACGAGATCCTCTCCGACTCGTACAATCT
CAAGGAGGTCGATGGCATCGTCTACGAGGCCGACTGTGCCATGATCACGGAGGAGGCTGTCAACGTCGGTACGTG
CATCTGTGCCGCCCGACGCGGCCTTGGCCCATGCTGACTCGGCACCTCCTCGCCTGCTGCAGACACCGGCGCCAA
CGCCTCGGCCGAGGGCGGCGACGAGGCCGTCGAGGACGAGGCCGTCAAGGTCAACAACATCGTCCACTCGTTCCG
CCTCCAGTCCACCCAGTTCGACAAGAAGAGCTTCCTCACCTACCTCAAGGGTGTGCATCCCAAGCCTCGCCTCTC
CCTGCCCGAGCTGACCTCGCCTTGTCCCTTGCGACAGGCTACATGAAGGCCGTCAAGGCCGCCCTCCAGGAGAAG
AATGCCTCGGCCGACACCATCACCGCCTTCGAGAAGGGCGCTCAGGCCTACGTCAAGGATAAGCTGCTACCCAAC
TTCAAGGACTTAGAGTTCTACACGGGCGAGACCATGAGCCCCGACGGACTGTATGCACCACCCAACCCCCTTCCC
TGCCCCCTTGCCGCCGAGCCGGCCGCGGCCGTCGAGTTGCAAGCAGTCGCTGACGCCGGGTGCCAGCGTTGTCCT
CCTCAATTACCGCGAGGACGGCGTCACCCCCTACGTCATCGTGTGGAAGCACGGCCTTACGGAGATGAAGGTCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail