Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3296
Gene name
LocationContig_185:612..2444
Strand-
Gene length (bp)1832
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.5E-17 213 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00616|NOR1_FUSLI Cytochrome P450 55A2 OS=Fusarium lichenicola GN=CYP55A2 PE=3 SV=1 5 407 0.0E+00
sp|P23295|NOR_FUSOX NADP nitrous oxide-forming nitric oxide reductase OS=Fusarium oxysporum GN=CYP55A1 PE=1 SV=2 5 407 0.0E+00
sp|Q12599|NOR2_FUSLI Cytochrome P450 55A3 OS=Fusarium lichenicola GN=CYP55A3 PE=3 SV=1 9 407 0.0E+00
sp|Q825I8|CYP28_STRAW Pentalenic acid synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cyp28 PE=1 SV=2 8 407 2.0E-91
sp|Q59831|CPS2_STRCC Cytochrome P450 105A3 OS=Streptomyces carbophilus GN=cyp105A3 PE=1 SV=3 3 407 5.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00616|NOR1_FUSLI Cytochrome P450 55A2 OS=Fusarium lichenicola GN=CYP55A2 PE=3 SV=1 5 407 0.0E+00
sp|P23295|NOR_FUSOX NADP nitrous oxide-forming nitric oxide reductase OS=Fusarium oxysporum GN=CYP55A1 PE=1 SV=2 5 407 0.0E+00
sp|Q12599|NOR2_FUSLI Cytochrome P450 55A3 OS=Fusarium lichenicola GN=CYP55A3 PE=3 SV=1 9 407 0.0E+00
sp|Q825I8|CYP28_STRAW Pentalenic acid synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cyp28 PE=1 SV=2 8 407 2.0E-91
sp|Q59831|CPS2_STRCC Cytochrome P450 105A3 OS=Streptomyces carbophilus GN=cyp105A3 PE=1 SV=3 3 407 5.0E-88
sp|P18326|CPXE_STRGO Vitamin D3 dihydroxylase OS=Streptomyces griseolus GN=cyp105A1 PE=1 SV=2 9 407 1.0E-85
sp|P18327|CPXF_STRGO Cytochrome P450-SU2 OS=Streptomyces griseolus GN=cyp105B1 PE=1 SV=2 1 407 6.0E-84
sp|P26911|CPXH_STRGR Cytochrome P450-SOY OS=Streptomyces griseus GN=cyp105D1 PE=3 SV=1 10 407 3.0E-83
sp|Q9ZHQ1|TYLH1_STRFR 20-oxo-5-O-mycaminosyltylactone 23-monooxygenase OS=Streptomyces fradiae GN=tylH1 PE=3 SV=1 10 407 2.0E-66
sp|Q83WF5|MYCCI_MICGR Mycinamicin VIII C21 methyl hydroxylase OS=Micromonospora griseorubida GN=mycCI PE=1 SV=3 11 383 7.0E-65
sp|Q59523|MYCG_MICGR Mycinamicin IV hydroxylase/epoxidase OS=Micromonospora griseorubida GN=mycG PE=1 SV=1 3 407 3.0E-61
sp|P33271|CPXK_SACEN Cytochrome P450 107B1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=cyp107B1 PE=1 SV=1 8 405 1.0E-58
sp|C4B644|CPVDH_PSEAH Vitamin D(3) 25-hydroxylase OS=Pseudonocardia autotrophica GN=vdh PE=1 SV=1 13 407 2.0E-58
sp|P23296|CPXG_STRSQ Cytochrome P450 105C1 OS=Streptomyces sp. GN=cyp105C1 PE=3 SV=1 1 407 3.0E-57
sp|E3VWI3|PNTM_STRAE Pentalenolactone synthase OS=Streptomyces arenae GN=pntM PE=1 SV=1 9 407 1.0E-54
sp|E3VWJ9|PENM_STREX Pentalenolactone synthase OS=Streptomyces exfoliatus GN=penM PE=1 SV=1 7 407 1.0E-54
sp|P9WPL6|CP141_MYCTO Putative cytochrome P450 141 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp141 PE=3 SV=1 9 407 8.0E-52
sp|P9WPL7|CP141_MYCTU Putative cytochrome P450 141 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp141 PE=1 SV=1 9 407 4.0E-51
sp|P46373|FAS1_RHOFA Cytochrome P450 FAS1 OS=Rhodococcus fascians GN=fas1 PE=2 SV=1 15 407 1.0E-50
sp|P53554|BIOI_BACSU Biotin biosynthesis cytochrome P450 OS=Bacillus subtilis (strain 168) GN=bioI PE=1 SV=1 21 407 2.0E-49
sp|Q8RN03|C5C4_AMYOR Cytochrome P450 165C4 OS=Amycolatopsis orientalis GN=cyp165C4 PE=1 SV=1 7 391 4.0E-49
sp|O87605|PIKC_STRVZ Cytochrome P450 monooxygenase PikC OS=Streptomyces venezuelae GN=pikC PE=1 SV=1 20 407 5.0E-49
sp|Q00441|CPXJ_SACEN 6-deoxyerythronolide B hydroxylase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryF PE=1 SV=2 25 405 5.0E-49
sp|Q59203|CPXP_BRADU Cytochrome P450 BJ-1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cyp112 PE=3 SV=2 9 407 9.0E-48
sp|O31785|PKSS_BACSU Polyketide biosynthesis cytochrome P450 PksS OS=Bacillus subtilis (strain 168) GN=pksS PE=3 SV=2 12 407 1.0E-47
sp|Q8RN04|C5B3_AMYOR Cytochrome P450 165B3 OS=Amycolatopsis orientalis GN=cyp165B3 PE=1 SV=1 15 407 1.0E-46
sp|Q8RN05|C5A3_AMYOR Cytochrome P450 165A3 OS=Amycolatopsis orientalis GN=cyp165A3 PE=3 SV=1 42 393 5.0E-45
sp|P55544|CPXP_RHISN Cytochrome P450 BJ-1 homolog OS=Rhizobium sp. (strain NGR234) GN=cyp112A2 PE=3 SV=1 9 407 1.0E-44
sp|O08469|CPXY_BACSU Cytochrome P450 OS=Bacillus subtilis (strain 168) GN=cypA PE=3 SV=1 14 407 1.0E-43
sp|Q9KZF5|C1581_STRCO Biflaviolin synthase CYP158A1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyp158a1 PE=1 SV=1 26 407 2.0E-43
sp|O34374|YJIB_BACSU Putative cytochrome P450 YjiB OS=Bacillus subtilis (strain 168) GN=yjiB PE=1 SV=1 14 398 5.0E-42
sp|Q9FCA6|C1582_STRCO Biflaviolin synthase CYP158A2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyp158a2 PE=1 SV=1 33 407 2.0E-41
sp|Q87AX5|C1331_XYLFT Putative cytochrome P450 133B1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cyp133B1 PE=3 SV=1 25 383 6.0E-40
sp|Q9KIZ4|C167_SORCE Cytochrome P450 167A1 OS=Sorangium cellulosum GN=cyp167A1 PE=1 SV=1 9 382 3.0E-39
sp|Q9PGC5|C1331_XYLFA Putative cytochrome P450 133B1 OS=Xylella fastidiosa (strain 9a5c) GN=cyp133B1 PE=3 SV=1 25 383 4.0E-39
sp|P33006|CPXL_PSESP Cytochrome P450-terp OS=Pseudomonas sp. GN=cyp108 PE=1 SV=1 25 385 1.0E-36
sp|Q84HB6|NCSB3_STRCZ 2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase OS=Streptomyces carzinostaticus GN=ncsB3 PE=1 SV=1 18 390 2.0E-36
sp|Q9PGE6|C1332_XYLFA Putative cytochrome P450 133B2 OS=Xylella fastidiosa (strain 9a5c) GN=cyp133B2 PE=3 SV=1 42 383 4.0E-36
sp|P9WPL5|CP142_MYCTU Putative cytochrome P450 142 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp142 PE=1 SV=1 14 407 8.0E-36
sp|P43492|THCB_RHOER Cytochrome P450 116 OS=Rhodococcus erythropolis GN=thcB PE=1 SV=2 12 393 1.0E-35
sp|P27632|CPXM_BACPZ Cytochrome P450 109 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=cyp109 PE=3 SV=1 25 405 1.0E-35
sp|P9WPL4|CP142_MYCTO Putative cytochrome P450 142 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp142 PE=3 SV=1 73 407 2.0E-35
sp|Q87AV9|C1332_XYLFT Putative cytochrome P450 133B2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cyp133B2 PE=3 SV=1 1 383 3.0E-34
sp|Q06069|CPXM_BACME Cytochrome P450(MEG) OS=Bacillus megaterium GN=cyp106A2 PE=1 SV=1 3 405 4.0E-34
sp|Q0S7M1|CP125_RHOJR Steroid C26-monooxygenase OS=Rhodococcus jostii (strain RHA1) GN=cyp125 PE=1 SV=1 21 380 8.0E-33
sp|P9WPP3|CP124_MYCTU Putative cytochrome P450 124 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp124 PE=1 SV=1 25 407 2.0E-32
sp|P0A517|CP124_MYCBO Putative cytochrome P450 124 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp124 PE=3 SV=1 25 407 2.0E-32
sp|P9WPL9|CP140_MYCTU Putative cytochrome P450 140 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp140 PE=1 SV=1 87 407 2.0E-32
sp|P9WPL8|CP140_MYCTO Putative cytochrome P450 140 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp140 PE=3 SV=1 87 407 2.0E-32
sp|P63722|CP140_MYCBO Putative cytochrome P450 140 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp140 PE=3 SV=1 87 407 2.0E-32
sp|P9WPN9|CP126_MYCTU Putative cytochrome P450 126 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp126 PE=1 SV=1 92 405 3.0E-32
sp|P9WPN8|CP126_MYCTO Putative cytochrome P450 126 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp126 PE=3 SV=1 92 405 3.0E-32
sp|P63712|CP126_MYCBO Putative cytochrome P450 126 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp126 PE=3 SV=1 92 405 3.0E-32
sp|P9WPL3|CP143_MYCTU Putative cytochrome P450 143 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp143 PE=1 SV=1 92 407 3.0E-31
sp|P9WPL2|CP143_MYCTO Putative cytochrome P450 143 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp143 PE=3 SV=1 92 407 3.0E-31
sp|P63724|CP143_MYCBO Putative cytochrome P450 143 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp143 PE=3 SV=1 92 407 3.0E-31
sp|P9WPP2|CP124_MYCTO Putative cytochrome P450 124 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp124 PE=3 SV=1 25 407 4.0E-31
sp|P9WPP1|CP125_MYCTU Steroid C26-monooxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp125 PE=1 SV=1 8 381 6.0E-31
sp|P9WPP0|CP125_MYCTO Steroid C26-monooxygenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp125 PE=1 SV=1 8 381 6.0E-31
sp|P63710|CP125_MYCBO Steroid C26-monooxygenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp125 PE=1 SV=1 8 381 6.0E-31
sp|P9WPP7|CP121_MYCTU Mycocyclosin synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp121 PE=1 SV=1 12 389 6.0E-31
sp|P9WPP6|CP121_MYCTO Mycocyclosin synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp121 PE=3 SV=1 12 389 6.0E-31
sp|P0A515|CP121_MYCBO Cytochrome P450 121 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp121 PE=3 SV=1 12 389 6.0E-31
sp|P48635|ERYK_SACEN Erythromycin C-12 hydroxylase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryK PE=1 SV=3 91 382 1.0E-29
sp|P9WPN5|CP130_MYCTU Cytochrome P450 130 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp130 PE=1 SV=1 25 383 5.0E-29
sp|P9WPN4|CP130_MYCTO Cytochrome P450 130 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp130 PE=3 SV=1 25 383 5.0E-29
sp|Q53215|Y4VG_RHISN Probable cytochrome P450 127A1 OS=Rhizobium sp. (strain NGR234) GN=cyp127A1 PE=3 SV=1 41 382 7.0E-29
sp|P14762|CPXI_BACME Cytochrome P450(BM-1) OS=Bacillus megaterium GN=cyp106 PE=1 SV=1 3 393 1.0E-28
sp|Q59204|CPXR_BRADU Cytochrome P450 BJ-3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cyp114 PE=3 SV=1 88 383 4.0E-28
sp|P9WPP5|CP123_MYCTU Putative cytochrome P450 123 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp123 PE=1 SV=1 1 382 4.0E-27
sp|P9WPP4|CP123_MYCTO Putative cytochrome P450 123 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp123 PE=3 SV=1 1 382 4.0E-27
sp|P63708|CP123_MYCBO Putative cytochrome P450 123 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp123 PE=3 SV=1 1 382 4.0E-27
sp|Q6N8N2|CYPA2_RHOPA Cytochrome p450 CYP199A2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cyp199a2 PE=1 SV=1 12 405 3.0E-26
sp|P00183|CPXA_PSEPU Camphor 5-monooxygenase OS=Pseudomonas putida GN=camC PE=1 SV=2 92 383 5.0E-26
sp|Q9L9F9|NOVI_STRNV Cytochrome P450 NovI OS=Streptomyces niveus GN=novI PE=3 SV=1 25 381 9.0E-26
sp|P9WPN7|CP128_MYCTU Putative cytochrome P450 128 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp128 PE=3 SV=1 12 385 2.0E-25
sp|P9WPN6|CP128_MYCTO Putative cytochrome P450 128 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp128 PE=3 SV=1 12 385 2.0E-25
sp|P63714|CP128_MYCBO Putative cytochrome P450 128 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp128 PE=3 SV=1 12 385 2.0E-25
sp|P55543|CPXR_RHISN Cytochrome P450 BJ-3 homolog OS=Rhizobium sp. (strain NGR234) GN=NGR_a02710 PE=3 SV=1 88 383 6.0E-25
sp|Q55080|CP119_SULAC Cytochrome P450 119 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cyp119 PE=1 SV=1 25 390 1.0E-23
sp|Q59723|CPXO_PSEPU Linalool 8-monooxygenase OS=Pseudomonas putida GN=linC PE=1 SV=1 194 404 1.0E-23
sp|B4XY99|AZIB1_STREG 5-methyl-1-naphthoate 3-hydroxylase OS=Streptomyces sahachiroi GN=aziB1 PE=1 SV=1 46 385 4.0E-23
sp|O34926|CYPX_BACSU Pulcherriminic acid synthase OS=Bacillus subtilis (strain 168) GN=cypX PE=1 SV=1 21 386 3.0E-21
sp|Q8VQF6|CINA_CITBR 1,8-cineole 2-endo-monooxygenase OS=Citrobacter braakii GN=cinA PE=1 SV=1 33 407 5.0E-21
sp|P24466|CPXC_RHIRD Cytochrome P450-pinF1, plant-inducible OS=Rhizobium radiobacter GN=cyp103 PE=2 SV=1 7 382 5.0E-21
sp|Q9ZAU3|DOXA_STRPE Cytochrome P-450 monooxygenase DoxA OS=Streptomyces peucetius GN=doxA PE=1 SV=1 22 392 2.0E-17
sp|Q59971|DOXA_STRS5 Cytochrome P-450 monooxygenase DoxA OS=Streptomyces sp. (strain C5) GN=doxA PE=1 SV=1 22 405 1.0E-16
sp|Q93MI2|DOXA_STRC0 Cytochrome P-450 monooxygenase DoxA OS=Streptomyces peucetius subsp. caesius GN=doxA PE=1 SV=1 22 392 5.0E-16
sp|Q54823|DNRQ_STRPE Anthracycline biosynthesis protein DnrQ OS=Streptomyces peucetius GN=dnrQ PE=3 SV=1 96 381 2.0E-15
sp|Q972I2|CP119_SULTO Cytochrome P450 119 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cyp119 PE=1 SV=1 25 375 1.0E-14
sp|Q9L4U5|AKNT_STRGJ Protein AknT OS=Streptomyces galilaeus GN=AknT PE=3 SV=1 141 380 3.0E-14
sp|P9WPL1|CP144_MYCTU Cytochrome P450 144 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp144 PE=1 SV=1 13 383 3.0E-12
sp|P9WPL0|CP144_MYCTO Cytochrome P450 144 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp144 PE=3 SV=1 13 383 3.0E-12
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 42 393 6.0E-12
sp|P24467|CPXD_RHIRD Cytochrome P450-pinF2, plant-inducible OS=Rhizobium radiobacter GN=cyp104 PE=2 SV=1 19 407 4.0E-11
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 181 397 5.0E-10
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 52 376 2.0E-09
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 52 376 2.0E-09
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 85 376 3.0E-09
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 93 400 3.0E-08
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 93 400 3.0E-08
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 93 400 3.0E-08
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 204 384 3.0E-08
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 190 385 5.0E-08
sp|P9WPM3|CP138_MYCTU Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 212 377 2.0E-07
sp|P9WPM2|CP138_MYCTO Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 212 377 2.0E-07
sp|P63718|CP138_MYCBO Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 212 377 2.0E-07
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 185 394 2.0E-07
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 279 376 2.0E-07
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 239 393 4.0E-07
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 88 382 4.0E-07
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 239 393 4.0E-07
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 189 393 2.0E-06
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 197 373 3.0E-06
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 196 373 4.0E-06
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 181 401 4.0E-06
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 212 407 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 237 259 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3296
MTVAAAEPPSFPFNRASGMEPPAEYARLRAAEPVSRVKLFDGSTAWLVTKYKDVTAVSTDNRLSKERIRPGFPEL
SAGGKAAAKARPTFVDMDPPDHMRQRGMIEPWFSDEHVKSLQPYIQKTVDDLLDGIIAKGCSDGPIDLVKEFALP
VPSRIIYTILGIPLEDLGFLTQQSEIRSNGSSTAREASAASQGLLEYLSSLVDKRSQEPGDDLISRLVVDQVRPG
HILAADAAQIAFLLIVAGNATVVNMITLGIVTLFQHPKQLAQLKAEPARAPQFVEELCRYHTASAVAMKRTAKVD
VEIGGKLIKAGEGIIASNQSANRDADVFDDPDKFDMNRHWPAGQDPLGFGYGDHRCVAETLAKTELTTVFATIFR
KLPQLKVAVPFEEINFTPLRKDVGIVDLPVTF*
Coding >Hirsu2|3296
ATGACCGTCGCCGCCGCCGAGCCGCCCAGCTTCCCCTTCAACCGGGCCTCGGGCATGGAGCCGCCGGCCGAGTAC
GCCCGGCTGCGGGCGGCCGAGCCCGTGTCCAGGGTCAAGCTGTTCGACGGCAGCACTGCCTGGCTCGTGACCAAG
TACAAGGACGTCACCGCCGTCTCGACCGATAACCGGCTGTCAAAGGAACGCATCCGGCCCGGCTTCCCCGAGCTG
AGCGCCGGAGGAAAAGCGGCGGCCAAGGCGCGACCGACGTTTGTCGACATGGACCCGCCGGATCATATGCGACAG
AGGGGCATGATCGAGCCCTGGTTCTCGGACGAGCACGTCAAGTCGCTGCAGCCGTACATCCAGAAAACCGTCGAC
GACCTCCTGGACGGCATCATCGCCAAGGGCTGCTCTGACGGTCCCATCGACCTGGTCAAGGAGTTTGCGCTGCCC
GTTCCATCACGAATCATCTACACCATCCTCGGCATTCCCCTCGAGGACCTTGGCTTCCTCACCCAGCAGAGCGAG
ATCCGCTCCAACGGCAGCTCGACGGCGCGAGAGGCCTCTGCCGCGAGCCAGGGACTCCTCGAATACCTCTCCAGT
CTCGTCGACAAGCGCAGCCAGGAGCCGGGAGACGATCTGATCAGCAGGCTGGTCGTCGACCAGGTGCGGCCTGGC
CATATCCTGGCCGCCGACGCGGCGCAGATTGCCTTCCTGCTCATCGTCGCCGGCAACGCGACCGTGGTCAACATG
ATCACCCTGGGCATCGTCACGCTGTTCCAGCACCCGAAGCAGCTGGCGCAGCTCAAGGCCGAGCCGGCGCGGGCG
CCCCAGTTCGTCGAGGAGCTGTGCCGATACCACACGGCGTCCGCCGTGGCCATGAAGCGGACGGCCAAGGTTGAC
GTCGAAATCGGCGGCAAGCTCATCAAAGCCGGCGAAGGCATCATCGCATCGAACCAGTCGGCCAACCGGGACGCA
GACGTCTTTGACGATCCGGACAAGTTCGACATGAACCGCCATTGGCCGGCCGGCCAGGACCCTCTTGGCTTCGGA
TACGGCGATCACCGATGCGTTGCCGAGACGCTGGCGAAGACGGAGCTGACGACAGTATTCGCCACCATCTTCCGG
AAGCTGCCACAGCTGAAGGTGGCCGTGCCATTCGAGGAGATCAACTTCACGCCGCTGCGCAAGGACGTCGGCATC
GTCGACCTGCCCGTCACCTTCTAG
Transcript >Hirsu2|3296
ATGACCGTCGCCGCCGCCGAGCCGCCCAGCTTCCCCTTCAACCGGGCCTCGGGCATGGAGCCGCCGGCCGAGTAC
GCCCGGCTGCGGGCGGCCGAGCCCGTGTCCAGGGTCAAGCTGTTCGACGGCAGCACTGCCTGGCTCGTGACCAAG
TACAAGGACGTCACCGCCGTCTCGACCGATAACCGGCTGTCAAAGGAACGCATCCGGCCCGGCTTCCCCGAGCTG
AGCGCCGGAGGAAAAGCGGCGGCCAAGGCGCGACCGACGTTTGTCGACATGGACCCGCCGGATCATATGCGACAG
AGGGGCATGATCGAGCCCTGGTTCTCGGACGAGCACGTCAAGTCGCTGCAGCCGTACATCCAGAAAACCGTCGAC
GACCTCCTGGACGGCATCATCGCCAAGGGCTGCTCTGACGGTCCCATCGACCTGGTCAAGGAGTTTGCGCTGCCC
GTTCCATCACGAATCATCTACACCATCCTCGGCATTCCCCTCGAGGACCTTGGCTTCCTCACCCAGCAGAGCGAG
ATCCGCTCCAACGGCAGCTCGACGGCGCGAGAGGCCTCTGCCGCGAGCCAGGGACTCCTCGAATACCTCTCCAGT
CTCGTCGACAAGCGCAGCCAGGAGCCGGGAGACGATCTGATCAGCAGGCTGGTCGTCGACCAGGTGCGGCCTGGC
CATATCCTGGCCGCCGACGCGGCGCAGATTGCCTTCCTGCTCATCGTCGCCGGCAACGCGACCGTGGTCAACATG
ATCACCCTGGGCATCGTCACGCTGTTCCAGCACCCGAAGCAGCTGGCGCAGCTCAAGGCCGAGCCGGCGCGGGCG
CCCCAGTTCGTCGAGGAGCTGTGCCGATACCACACGGCGTCCGCCGTGGCCATGAAGCGGACGGCCAAGGTTGAC
GTCGAAATCGGCGGCAAGCTCATCAAAGCCGGCGAAGGCATCATCGCATCGAACCAGTCGGCCAACCGGGACGCA
GACGTCTTTGACGATCCGGACAAGTTCGACATGAACCGCCATTGGCCGGCCGGCCAGGACCCTCTTGGCTTCGGA
TACGGCGATCACCGATGCGTTGCCGAGACGCTGGCGAAGACGGAGCTGACGACAGTATTCGCCACCATCTTCCGG
AAGCTGCCACAGCTGAAGGTGGCCGTGCCATTCGAGGAGATCAACTTCACGCCGCTGCGCAAGGACGTCGGCATC
GTCGACCTGCCCGTCACCTTCTAG
Gene >Hirsu2|3296
ATGACCGTCGCCGCCGCCGAGCCGCCCAGCTTCCCCTTCAACCGGGCCTCGGGCATGGAGCCGCCGGCCGAGTAC
GCCCGGCTGCGGGCGGCCGAGCCCGTGTCCAGGGTCAAGCTGTTCGACGGCAGCACTGCCTGGCTCGTGACCAAG
TACAAGGACGTCACCGCCGTCTCGACCGATAACCGGCTGTCAAAGGTAGGCCTGCCCCCCTGTTCCCTGTCGTTG
TCTCGGGAGAGGCGTGCCGGCTCACGTGGCGTGCGGCCTTAATGTAGGAACGCATCCGGCCCGGCTTCCCCGAGC
TGAGCGCCGGAGGAAAAGCGGCGGCCAAGGCGCGACCGACGTTTGTCGACATGGACCCGCCGGATCATATGCGAC
AGAGGCAAGTTTCCCTCTGTGCCTTCAACAACCATGTTCCATGAGCACGACTGACTTGCCCTGCAGGGGCATGAT
CGAGCCCTGGTTCTCGGACGAGCACGTCAAGTCGCTGCAGCCGTACATCCAGAAAACCGTCGACGACCTCCTGGA
CGGCATCATCGCCAAGGGCTGCTCTGACGGTCCCATCGACCTGGTCAAGGAGTTTGCGCTGCCCGTTCCATCACG
AGTATGTATCTACTCTCCTCGTCATTGCGGACCGGCAGCCTGTCCACCGGGCCCAGAAAGGCATGTGCCGTTGCG
AATGACGCTGACAAGGCCATCTCCGCCTAGATCATCTACACCATCCTCGGCATTCCCCTCGAGGACCTTGGCTTC
CTCACCCAGCAGAGCGAGATCCGCTCCAACGGCAGCTCGACGGCGCGAGAGGCCTCTGCCGCGAGCCAGTATGTG
CCCTTCCCATCCTTCATCGGCCAGCCACAAGGGACTCTGGCGAAAAGCGGTGGCGGCGGCGGCGGTGCTTGAACG
TGCGAGCCGGCTAACCGAAGCGCAGGGGACTCCTCGAATACCTCTCCAGTCTCGTCGACAAGCGCAGCCAGGAGC
CGGGAGACGATCTGATCAGCAGGCTGGTCGTCGACCAGGTGCGGCCTGGCCATATCCTGGCCGCCGACGCGGCGC
AGATTGCCTTCCTGCTCATCGTCGCCGGCAACGCGACCGTGGTCAACATGATCACCCTGGTGCGTCTCCGTCCCA
CTCCACGCGTGCGCACTGACGATGCTAACGCTGGGCGCCGTCACCACAGGGCATCGTCACGCTGTTCCAGCACCC
GAAGCAGCTGGCGCAGCTCAAGGCCGAGCCGGCGCGGGCGCCCCAGTTCGTCGAGGAGCTGTGCCGATACCACAC
GGCGTCCGCCGTGGCCATGAAGCGGACGGCCAAGGTTGACGTCGAAATCGGCGGCAAGGTATGTGTATTAACCCG
GATGGCCAGCTGCCCATGTCCCTCCACGACTCCCCAAGTCAAGAAGCTCCTCTTGTGAACCATGACGGGAAGGCT
GACGGGACGACAACTCGTTGCACAGCTCATCAAAGCCGGCGAAGGCATCATCGCATCGAACCAGTCGGCCAACCG
GGACGCAGACGTCTTTGACGATCCGGACAAGTTCGACATGAACCGCCATTGGCCGGCCGGCCAGGACCCTCTTGG
CTTCGGATACGGCGATCACCGATGCGTTGCCGAGACGCTGGCGAAGACGGAGCTGACGACAGTATTCGGTGAGTT
TTTTTTCCCTTGGTCTCCTTCCAACCCAAGAAGCCTAGACAGCTGACGGGATGATGCGTCCCCCATCAGCCACCA
TCTTCCGGAAGCTGCCACAGCTGAAGGTGGCCGTGCCATTCGAGGAGATCAACTTCACGCCGCTGCGCAAGGACG
TCGGCATCGTCGACCTGCCCGTCACCTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail