Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3282
Gene name
LocationContig_1841:2215..3441
Strand+
Gene length (bp)1226
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00490 ALAD Delta-aminolevulinic acid dehydratase 7.0E-121 67 382

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P05373|HEM2_YEAST Delta-aminolevulinic acid dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM2 PE=1 SV=2 58 385 2.0E-161
sp|O42768|HEM2_CANGA Delta-aminolevulinic acid dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM2 PE=3 SV=1 58 385 2.0E-160
sp|Q750E0|HEM2_ASHGO Delta-aminolevulinic acid dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM2 PE=3 SV=1 59 383 5.0E-150
sp|P06214|HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus GN=Alad PE=1 SV=1 61 385 6.0E-128
sp|Q58DK5|HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus GN=ALAD PE=2 SV=1 61 385 6.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P05373|HEM2_YEAST Delta-aminolevulinic acid dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM2 PE=1 SV=2 58 385 2.0E-161
sp|O42768|HEM2_CANGA Delta-aminolevulinic acid dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM2 PE=3 SV=1 58 385 2.0E-160
sp|Q750E0|HEM2_ASHGO Delta-aminolevulinic acid dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM2 PE=3 SV=1 59 383 5.0E-150
sp|P06214|HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus GN=Alad PE=1 SV=1 61 385 6.0E-128
sp|Q58DK5|HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus GN=ALAD PE=2 SV=1 61 385 6.0E-128
sp|P10518|HEM2_MOUSE Delta-aminolevulinic acid dehydratase OS=Mus musculus GN=Alad PE=1 SV=1 61 385 7.0E-128
sp|P13716|HEM2_HUMAN Delta-aminolevulinic acid dehydratase OS=Homo sapiens GN=ALAD PE=1 SV=1 61 385 8.0E-128
sp|P78974|HEM2_SCHPO Delta-aminolevulinic acid dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem2 PE=2 SV=2 58 385 1.0E-127
sp|Q60HH9|HEM2_MACFA Delta-aminolevulinic acid dehydratase OS=Macaca fascicularis GN=ALAD PE=2 SV=2 61 384 1.0E-127
sp|Q5R971|HEM2_PONAB Delta-aminolevulinic acid dehydratase OS=Pongo abelii GN=ALAD PE=2 SV=2 61 385 4.0E-127
sp|Q55E06|HEM2_DICDI Delta-aminolevulinic acid dehydratase OS=Dictyostelium discoideum GN=alad PE=3 SV=2 58 384 4.0E-117
sp|Q02250|HEM2_METSC Delta-aminolevulinic acid dehydratase OS=Methanothermus sociabilis GN=hemB PE=3 SV=1 73 383 8.0E-81
sp|O67876|HEM2_AQUAE Delta-aminolevulinic acid dehydratase OS=Aquifex aeolicus (strain VF5) GN=hemB PE=3 SV=1 78 375 1.0E-80
sp|Q9K8G2|HEM2_BACHD Delta-aminolevulinic acid dehydratase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemB PE=3 SV=1 73 385 5.0E-79
sp|P30950|HEM2_BACSU Delta-aminolevulinic acid dehydratase OS=Bacillus subtilis (strain 168) GN=hemB PE=3 SV=1 69 383 8.0E-77
sp|O26839|HEM2_METTH Delta-aminolevulinic acid dehydratase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hemB PE=3 SV=1 70 380 2.0E-75
sp|P64335|HEM2_STAAW Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain MW2) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|Q2FXR3|HEM2_STAA8 Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain NCTC 8325) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|Q5HFA4|HEM2_STAAC Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain COL) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|P64333|HEM2_STAAM Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|P64334|HEM2_STAAN Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain N315) GN=hemB PE=1 SV=1 73 384 2.0E-74
sp|Q6GG37|HEM2_STAAR Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain MRSA252) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|Q6G8Q7|HEM2_STAAS Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus (strain MSSA476) GN=hemB PE=3 SV=1 73 384 2.0E-74
sp|Q60178|HEM2_METJA Delta-aminolevulinic acid dehydratase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hemB PE=3 SV=1 73 378 4.0E-74
sp|Q8CNZ0|HEM2_STAES Delta-aminolevulinic acid dehydratase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemB PE=3 SV=1 73 384 1.0E-72
sp|Q5HNN5|HEM2_STAEQ Delta-aminolevulinic acid dehydratase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemB PE=3 SV=1 73 384 1.0E-72
sp|P0C1R9|HEM2_STAAU Delta-aminolevulinic acid dehydratase OS=Staphylococcus aureus GN=hemB PE=3 SV=1 73 374 2.0E-72
sp|P43087|HEM2_SYNE7 Delta-aminolevulinic acid dehydratase OS=Synechococcus elongatus (strain PCC 7942) GN=hemB PE=3 SV=2 78 383 4.0E-72
sp|O28305|HEM2_ARCFU Delta-aminolevulinic acid dehydratase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hemB PE=3 SV=1 78 384 3.0E-70
sp|Q8KCJ0|HEM2_CHLTE Delta-aminolevulinic acid dehydratase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemB PE=3 SV=1 78 378 9.0E-69
sp|Q9PLU4|HEM2_CHLMU Delta-aminolevulinic acid dehydratase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=hemB PE=3 SV=1 73 383 3.0E-68
sp|P56074|HEM2_HELPY Delta-aminolevulinic acid dehydratase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemB PE=3 SV=1 73 384 1.0E-67
sp|Q9ZMR8|HEM2_HELPJ Delta-aminolevulinic acid dehydratase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemB PE=3 SV=1 73 384 2.0E-67
sp|Q9Z7G1|HEM2_CHLPN Delta-aminolevulinic acid dehydratase OS=Chlamydia pneumoniae GN=hemB PE=3 SV=1 73 385 3.0E-67
sp|P9WMP5|HEM2_MYCTU Delta-aminolevulinic acid dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hemB PE=1 SV=1 73 383 1.0E-66
sp|P9WMP4|HEM2_MYCTO Delta-aminolevulinic acid dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hemB PE=3 SV=1 73 383 1.0E-66
sp|O84638|HEM2_CHLTR Delta-aminolevulinic acid dehydratase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=hemB PE=3 SV=1 73 383 1.0E-66
sp|Q59334|HEM2_CHLP8 Delta-aminolevulinic acid dehydratase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemB PE=1 SV=1 78 378 5.0E-66
sp|Q59643|HEM2_PSEAE Delta-aminolevulinic acid dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hemB PE=1 SV=1 71 383 2.0E-65
sp|P30124|HEM2_PEA Delta-aminolevulinic acid dehydratase, chloroplastic (Fragment) OS=Pisum sativum GN=HEMB PE=1 SV=1 70 378 2.0E-64
sp|P77969|HEM2_SYNY3 Delta-aminolevulinic acid dehydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemB PE=1 SV=1 78 384 1.0E-63
sp|P77923|HEM2_PROFF Delta-aminolevulinic acid dehydratase OS=Propionibacterium freudenreichii subsp. freudenreichii GN=hemB PE=3 SV=1 70 385 2.0E-63
sp|P46723|HEM2_MYCLE Delta-aminolevulinic acid dehydratase OS=Mycobacterium leprae (strain TN) GN=hemB PE=3 SV=1 70 383 2.0E-63
sp|P0ACB2|HEM2_ECOLI Delta-aminolevulinic acid dehydratase OS=Escherichia coli (strain K12) GN=hemB PE=1 SV=2 70 375 3.0E-63
sp|P0ACB3|HEM2_SHIFL Delta-aminolevulinic acid dehydratase OS=Shigella flexneri GN=hemB PE=3 SV=2 70 375 3.0E-63
sp|P54919|HEM2_STRCO Delta-aminolevulinic acid dehydratase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemB PE=3 SV=2 70 378 4.0E-63
sp|P45622|HEM2_BRADU Delta-aminolevulinic acid dehydratase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hemB PE=1 SV=1 72 378 4.0E-62
sp|Q9SFH9|HEM21_ARATH Delta-aminolevulinic acid dehydratase 1, chloroplastic OS=Arabidopsis thaliana GN=HEMB1 PE=2 SV=1 70 378 4.0E-62
sp|P45623|HEM2_SELMA Delta-aminolevulinic acid dehydratase, chloroplastic OS=Selaginella martensii GN=HEMB PE=3 SV=1 78 383 5.0E-62
sp|Q5Z8V9|HEM2_ORYSJ Delta-aminolevulinic acid dehydratase, chloroplastic OS=Oryza sativa subsp. japonica GN=HEMB PE=2 SV=1 58 383 2.0E-61
sp|Q43058|HEM2_PHYPA Delta-aminolevulinic acid dehydratase, chloroplastic OS=Physcomitrella patens subsp. patens GN=HEMB PE=2 SV=2 70 383 5.0E-59
sp|P24493|HEM2_SPIOL Delta-aminolevulinic acid dehydratase, chloroplastic OS=Spinacia oleracea GN=HEMB PE=1 SV=2 70 378 5.0E-59
sp|Q42836|HEM2_HORVU Delta-aminolevulinic acid dehydratase, chloroplastic OS=Hordeum vulgare GN=HEMB PE=2 SV=1 70 378 3.0E-58
sp|P43210|HEM2_SOYBN Delta-aminolevulinic acid dehydratase, chloroplastic OS=Glycine max GN=HEMB PE=2 SV=1 70 374 3.0E-57
sp|Q42682|HEM2_CHLRE Delta-aminolevulinic acid dehydratase, chloroplastic OS=Chlamydomonas reinhardtii GN=HEMB PE=2 SV=1 78 383 6.0E-53
sp|Q94LA4|HEM22_ARATH Probable delta-aminolevulinic acid dehydratase 2, chloroplastic OS=Arabidopsis thaliana GN=HEMB2 PE=3 SV=1 70 378 4.0E-47
sp|P42504|HEM2_RHOCA Delta-aminolevulinic acid dehydratase OS=Rhodobacter capsulatus GN=hemB PE=1 SV=1 73 377 7.0E-47
sp|Q59295|HEM2_CLOJO Delta-aminolevulinic acid dehydratase (Fragment) OS=Clostridium josui GN=hemB PE=3 SV=1 78 268 6.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0033014 tetrapyrrole biosynthetic process Yes
GO:0046872 metal ion binding Yes
GO:0004655 porphobilinogen synthase activity Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0016829 lyase activity No
GO:0016836 hydro-lyase activity No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0033013 tetrapyrrole metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043167 ion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3282
MSFSNLVQNLSLRDAEGARRPGPPGSSISSTADDRTSRISRAMSYTSTAATSVSISGDISSQLHGGYFHPLARSW
QAERQLTKSMLIYPLFVTDGDDDMILVPSLPGQHQLSVSRLVPFLEPLVHKGLRSVILFGVPLKPGSKDALGSAA
DDPQGPVIQAIRLIRRRFPQIFICTDVCLCEYTSHGHCGILRDDGSLNNQLSVDRISDVAIAYAKAGAHCVAPSD
MNDGRIRAIKLKLIEEGIAHKTVLMSYSAKFSGCLYGPFRDAAGSAPSFGDRKCYQLPPGGRGLARRAIVRDIGE
GADIIMVKPASQYLDIISDAKELGKDLPVAAYQVSGEYAMIHAGAKAGVFDLKTMAFESTEGILRAGATIVVSYF
TPQFLDWLEH*
Coding >Hirsu2|3282
ATGTCCTTCTCGAACCTCGTCCAGAACTTGAGCCTGCGCGACGCCGAGGGCGCCCGTCGCCCCGGCCCGCCGGGA
TCCAGCATCAGCTCCACGGCCGACGACCGGACGTCGCGCATCTCTCGCGCCATGTCGTACACCAGCACCGCGGCC
ACGAGCGTCAGTATCTCGGGCGACATCTCCAGCCAGCTGCACGGGGGCTACTTCCACCCCCTGGCCCGCTCCTGG
CAGGCCGAGCGGCAGTTGACCAAGTCCATGCTGATCTACCCCCTCTTCGTGACGGATGGCGACGACGACATGATC
CTTGTTCCGTCGCTGCCGGGCCAGCATCAGCTCAGCGTCAGCAGGCTGGTGCCCTTCCTCGAGCCGCTGGTGCAC
AAGGGCCTGCGGTCCGTCATCCTCTTCGGCGTCCCGCTCAAGCCCGGCAGCAAGGACGCGCTCGGCAGCGCGGCC
GACGATCCCCAGGGCCCCGTCATCCAGGCCATCCGCCTGATCCGCCGGCGCTTCCCCCAGATCTTCATCTGCACC
GACGTCTGCCTCTGCGAGTACACGTCGCACGGCCACTGCGGCATCCTGCGCGACGACGGCAGCCTCAACAACCAG
CTGTCGGTGGACCGCATCTCGGACGTGGCCATCGCCTACGCCAAGGCCGGCGCCCACTGCGTCGCGCCCTCGGAC
ATGAACGACGGCCGCATCCGCGCCATCAAGCTCAAGCTGATCGAGGAGGGCATCGCCCACAAGACGGTCCTCATG
TCGTACTCGGCCAAGTTCTCGGGCTGCCTGTACGGGCCCTTCCGGGACGCGGCCGGCTCGGCGCCCTCGTTTGGG
GATCGCAAGTGCTACCAGCTGCCCCCGGGGGGCCGGGGCCTGGCCCGGCGGGCGATTGTGCGCGACATCGGCGAG
GGCGCCGACATCATCATGGTCAAGCCGGCCAGCCAGTACCTCGACATCATCAGCGACGCCAAGGAGCTGGGCAAG
GACCTGCCCGTTGCCGCCTACCAAGTCAGCGGCGAGTATGCCATGATCCACGCCGGGGCCAAGGCCGGTGTCTTT
GACCTCAAGACCATGGCCTTTGAATCGACCGAGGGCATCCTCCGGGCGGGGGCCACCATCGTCGTGAGCTACTTC
ACGCCTCAGTTCCTCGACTGGCTGGAGCACTAG
Transcript >Hirsu2|3282
ATGTCCTTCTCGAACCTCGTCCAGAACTTGAGCCTGCGCGACGCCGAGGGCGCCCGTCGCCCCGGCCCGCCGGGA
TCCAGCATCAGCTCCACGGCCGACGACCGGACGTCGCGCATCTCTCGCGCCATGTCGTACACCAGCACCGCGGCC
ACGAGCGTCAGTATCTCGGGCGACATCTCCAGCCAGCTGCACGGGGGCTACTTCCACCCCCTGGCCCGCTCCTGG
CAGGCCGAGCGGCAGTTGACCAAGTCCATGCTGATCTACCCCCTCTTCGTGACGGATGGCGACGACGACATGATC
CTTGTTCCGTCGCTGCCGGGCCAGCATCAGCTCAGCGTCAGCAGGCTGGTGCCCTTCCTCGAGCCGCTGGTGCAC
AAGGGCCTGCGGTCCGTCATCCTCTTCGGCGTCCCGCTCAAGCCCGGCAGCAAGGACGCGCTCGGCAGCGCGGCC
GACGATCCCCAGGGCCCCGTCATCCAGGCCATCCGCCTGATCCGCCGGCGCTTCCCCCAGATCTTCATCTGCACC
GACGTCTGCCTCTGCGAGTACACGTCGCACGGCCACTGCGGCATCCTGCGCGACGACGGCAGCCTCAACAACCAG
CTGTCGGTGGACCGCATCTCGGACGTGGCCATCGCCTACGCCAAGGCCGGCGCCCACTGCGTCGCGCCCTCGGAC
ATGAACGACGGCCGCATCCGCGCCATCAAGCTCAAGCTGATCGAGGAGGGCATCGCCCACAAGACGGTCCTCATG
TCGTACTCGGCCAAGTTCTCGGGCTGCCTGTACGGGCCCTTCCGGGACGCGGCCGGCTCGGCGCCCTCGTTTGGG
GATCGCAAGTGCTACCAGCTGCCCCCGGGGGGCCGGGGCCTGGCCCGGCGGGCGATTGTGCGCGACATCGGCGAG
GGCGCCGACATCATCATGGTCAAGCCGGCCAGCCAGTACCTCGACATCATCAGCGACGCCAAGGAGCTGGGCAAG
GACCTGCCCGTTGCCGCCTACCAAGTCAGCGGCGAGTATGCCATGATCCACGCCGGGGCCAAGGCCGGTGTCTTT
GACCTCAAGACCATGGCCTTTGAATCGACCGAGGGCATCCTCCGGGCGGGGGCCACCATCGTCGTGAGCTACTTC
ACGCCTCAGTTCCTCGACTGGCTGGAGCACTAG
Gene >Hirsu2|3282
ATGTCCTTCTCGAACCTCGTCCAGAACTTGAGCCTGCGCGACGCCGAGGGCGCCCGTCGCCCCGGCCCGCCGGGA
TCCAGCATCAGCTCCACGGCCGACGACCGGACGTCGCGCATCTCTCGCGCCATGTCGTACACCAGCACCGCGGCC
ACGAGCGTCAGTATCTCGGGCGACATCTCCAGCCAGCTGCACGGGGGCTACTTCCACCCCCTGGCCCGCTCCTGG
CAGGCCGAGCGGCAGTTGACCAAGGTGAGAGGGAGAGGAGGGGCCGTGATTTTCGGGCGGCAAATCGGTGGCTGA
CTCGATCTCTTCCGCAGTCCATGCTGATCTACCCCCTCTTCGTGACGGATGGCGACGACGACATGATCCTTGTTC
CGTCGCTGCCGGGCCAGCATCAGCTCAGCGTCAGCAGGCTGGTGCCCTTCCTCGAGCCGCTGGTGCACAAGGGCC
TGCGGTCCGTCATCCTCTTCGGCGTCCCGCTCAAGCCCGGCAGCAAGGACGCGCTCGGCAGCGCGGCCGACGATC
CCCAGGGCCCCGTCATCCAGGCCATCCGCCTGATCCGCCGGCGCTTCCCCCAGATCTTCATCTGCACCGACGTCT
GCCTCTGCGAGTACACGTCGCACGGCCACTGCGGCATCCTGCGCGACGACGGCAGCCTCAACAACCAGCTGTCGG
TGGACCGCATCTCGGACGTGGCCATCGCCTACGCCAAGGCCGGCGCCCACTGCGTCGCGCCCTCGGACATGAACG
ACGGCCGCATCCGCGCCATCAAGCTCAAGCTGATCGAGGAGGGCATCGCCCACAAGACGGTCCTCATGTCGTACT
CGGCCAAGTTCTCGGGCTGCCTGTACGGGCCCTTCCGGGACGCGGCCGGCTCGGCGCCCTCGTTTGGGGATCGCA
AGTGCTACCAGCTGCCCCCGGGGGGCCGGGGCCTGGCCCGGCGGGCGATTGTGCGCGACATCGGCGAGGGCGCCG
ACATCATCATGGTCAAGCCGGCCAGCCAGTACCTCGACATCATCAGCGACGCCAAGGAGCTGGGCAAGGACCTGC
CCGTTGCCGCCTACCAAGTCAGCGGCGAGTATGCCATGATCCACGCCGGGGCCAAGGCCGGTGTCTTTGACCTCA
AGACCATGGCCTTTGAATCGACCGAGGGCATCCTCCGGGCGGGGGCCACCATCGTCGTGAGCTACTTCACGCCTC
AGTTCCTCGACTGGCTGGAGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail