Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3277
Gene name
LocationContig_184:30232..31348
Strand+
Gene length (bp)1116
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08242 Methyltransf_12 Methyltransferase domain 7.0E-11 263 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 362 1.0E-30
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 114 351 7.0E-18
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 114 351 3.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 183 351 3.0E-15
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 260 368 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 362 1.0E-30
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 114 351 7.0E-18
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 114 351 3.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 183 351 3.0E-15
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 260 368 5.0E-07
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 216 365 8.0E-07
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 260 368 9.0E-07
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 260 368 9.0E-07
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 260 368 9.0E-07
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 260 368 1.0E-06
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 260 368 2.0E-06
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 260 368 3.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5203 0.4858 0.1691 0.0973 0.0457 0.0294 0.0931 0.0546 0.1993 0.0815

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6951
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|11186
Ophiocordyceps subramaniannii Hirsu2|3121
Ophiocordyceps subramaniannii Hirsu2|3277 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3277
MVANRIETLYIADPLGEATTSLWKAYGQTQRKTSTIYRSDVTIYESGELAEPRPRLSIKGLDLVLLSTDNRERVQ
IGEDTFFVETWKPDAKMMTSVNDLPVCNELPADLTPVFTRDDHEAFQLASSIFVLDSLEIINGLNLADLPSHLRA
FVDWIKTEAENITQGRAPFVDVATLDRVRANPDLRNGLLKRVSKWNARGELVIRVGSNVKPILKQETDSLEFMFG
GDDIMSRTYDEGLPGDVAVHLGQYLDCLAHNQSGLRILEVGGGTGSATRVILDAFRRAGGRDAVDGIAPIARYDF
TDISAAFFEKAKSRFADWSDVVRCKTFDIEKDARQQGFEHGAYDIILASSVSSMKSALSASLPSLDNMRDN*
Coding >Hirsu2|3277
ATGGTTGCCAACCGCATCGAAACCCTTTACATTGCGGACCCCCTCGGGGAGGCCACGACCAGCCTGTGGAAGGCA
TATGGTCAGACCCAGAGGAAAACGTCGACCATCTACAGATCAGATGTGACAATCTACGAGTCCGGAGAGCTAGCC
GAGCCCCGGCCCCGGTTATCAATAAAGGGACTGGATCTTGTCCTTCTGTCCACAGACAACCGCGAGCGCGTGCAA
ATCGGGGAGGACACCTTCTTCGTGGAGACTTGGAAGCCTGACGCCAAGATGATGACGAGCGTGAATGATCTCCCG
GTCTGCAACGAGTTGCCTGCTGACCTGACGCCCGTCTTCACCAGAGATGACCACGAGGCATTCCAGCTCGCGAGC
AGCATCTTCGTGCTGGACTCGCTCGAGATAATCAATGGCCTCAATCTCGCCGACCTCCCCTCACATCTCAGGGCC
TTTGTCGACTGGATCAAGACGGAGGCGGAGAACATCACTCAGGGGCGCGCCCCTTTCGTCGATGTCGCGACGCTG
GACCGCGTCCGCGCCAACCCCGATCTCAGAAACGGTCTGCTCAAACGAGTCTCGAAGTGGAACGCCCGAGGCGAG
CTGGTCATACGGGTCGGAAGCAACGTGAAGCCGATCCTGAAGCAGGAAACGGACAGCCTGGAGTTCATGTTCGGC
GGCGACGATATCATGAGCCGGACCTACGACGAGGGCTTGCCGGGCGACGTTGCCGTCCACCTCGGGCAGTATCTC
GACTGCCTGGCGCACAACCAATCGGGCCTCAGGATCCTCGAGGTCGGCGGCGGCACGGGCAGTGCGACCAGGGTG
ATCCTAGACGCGTTCAGGCGGGCGGGCGGGCGAGATGCGGTAGACGGCATCGCGCCCATCGCCAGGTATGACTTC
ACCGACATCTCGGCCGCCTTTTTCGAAAAGGCCAAGAGCCGCTTCGCCGACTGGTCCGACGTTGTGCGCTGCAAG
ACGTTCGACATCGAGAAGGACGCGAGGCAGCAAGGGTTCGAGCACGGGGCCTATGATATCATCTTGGCGTCTTCG
GTCAGTTCCATGAAGTCGGCCTTGTCTGCCAGTTTGCCCAGCCTCGACAATATGCGTGACAACTGA
Transcript >Hirsu2|3277
ATGGTTGCCAACCGCATCGAAACCCTTTACATTGCGGACCCCCTCGGGGAGGCCACGACCAGCCTGTGGAAGGCA
TATGGTCAGACCCAGAGGAAAACGTCGACCATCTACAGATCAGATGTGACAATCTACGAGTCCGGAGAGCTAGCC
GAGCCCCGGCCCCGGTTATCAATAAAGGGACTGGATCTTGTCCTTCTGTCCACAGACAACCGCGAGCGCGTGCAA
ATCGGGGAGGACACCTTCTTCGTGGAGACTTGGAAGCCTGACGCCAAGATGATGACGAGCGTGAATGATCTCCCG
GTCTGCAACGAGTTGCCTGCTGACCTGACGCCCGTCTTCACCAGAGATGACCACGAGGCATTCCAGCTCGCGAGC
AGCATCTTCGTGCTGGACTCGCTCGAGATAATCAATGGCCTCAATCTCGCCGACCTCCCCTCACATCTCAGGGCC
TTTGTCGACTGGATCAAGACGGAGGCGGAGAACATCACTCAGGGGCGCGCCCCTTTCGTCGATGTCGCGACGCTG
GACCGCGTCCGCGCCAACCCCGATCTCAGAAACGGTCTGCTCAAACGAGTCTCGAAGTGGAACGCCCGAGGCGAG
CTGGTCATACGGGTCGGAAGCAACGTGAAGCCGATCCTGAAGCAGGAAACGGACAGCCTGGAGTTCATGTTCGGC
GGCGACGATATCATGAGCCGGACCTACGACGAGGGCTTGCCGGGCGACGTTGCCGTCCACCTCGGGCAGTATCTC
GACTGCCTGGCGCACAACCAATCGGGCCTCAGGATCCTCGAGGTCGGCGGCGGCACGGGCAGTGCGACCAGGGTG
ATCCTAGACGCGTTCAGGCGGGCGGGCGGGCGAGATGCGGTAGACGGCATCGCGCCCATCGCCAGGTATGACTTC
ACCGACATCTCGGCCGCCTTTTTCGAAAAGGCCAAGAGCCGCTTCGCCGACTGGTCCGACGTTGTGCGCTGCAAG
ACGTTCGACATCGAGAAGGACGCGAGGCAGCAAGGGTTCGAGCACGGGGCCTATGATATCATCTTGGCGTCTTCG
GTCAGTTCCATGAAGTCGGCCTTGTCTGCCAGTTTGCCCAGCCTCGACAATATGCGTGACAACTGA
Gene >Hirsu2|3277
ATGGTTGCCAACCGCATCGAAACCCTTTACATTGCGGACCCCCTCGGGGAGGCCACGACCAGCCTGTGGAAGGCA
TATGGTCAGACCCAGAGGAAAACGTCGACCATCTACAGATCAGATGTGACAATCTACGAGTCCGGAGAGCTAGCC
GAGCCCCGGCCCCGGTTATCAATAAAGGGACTGGATCTTGTCCTTCTGTCCACAGACAACCGCGAGCGCGTGCAA
ATCGGGGAGGACACCTTCTTCGTGGAGACTTGGAAGCCTGACGCCAAGATGATGACGAGCGTGAATGATCTCCCG
GTCTGCAACGAGTTGCCTGCTGACCTGACGCCCGTCTTCACCAGAGATGACCACGAGGCATTCCAGCTCGCGAGC
AGCATCTTCGTGCTGGACTCGCTCGAGATAATCAATGGCCTCAATCTCGCCGACCTCCCCTCACATCTCAGGGCC
TTTGTCGACTGGATCAAGACGGAGGCGGAGAACATCACTCAGGGGCGCGCCCCTTTCGTCGATGTCGCGACGCTG
GACCGCGTCCGCGCCAACCCCGATCTCAGAAACGGTCTGCTCAAACGAGTCTCGAAGTGGAACGCCCGAGGCGAG
CTGGTCATACGGGTCGGAAGCAACGTGAAGCCGATCCTGAAGCAGGAAACGGACAGCCTGGAGTTCATGTTCGGC
GGCGACGATATCATGAGCCGGACCTACGACGAGGGCTTGCCGGGCGACGTTGCCGTCCACCTCGGGCAGTATCTC
GACTGCCTGGCGCACAACCAATCGGGCCTCAGGATCCTCGAGGTCGGCGGCGGCACGGGCAGTGCGACCAGGGTG
ATCCTAGACGCGTTCAGGCGGGCGGGCGGGCGAGATGCGGTAGACGGCATCGCGCCCATCGCCAGGTATGACTTC
ACCGACATCTCGGCCGCCTTTTTCGAAAAGGCCAAGAGCCGCTTCGCCGACTGGTCCGACGTTGTGCGCTGCAAG
ACGTTCGACATCGAGAAGGACGCGAGGCAGCAAGGGTTCGAGCACGGGGCCTATGATATCATCTTGGCGTCTTCG
GTCAGTTCCATGAAGTCGGCCTTGTCTGCCAGTTTGCCCAGCCTCGACAATATGCGTGACAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail