Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3275
Gene name
LocationContig_184:22680..23728
Strand+
Gene length (bp)1048
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 9.8E-12 59 284

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 182 204 22
2 224 246 22
3 267 289 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3275
MCKINISRLDIGNGLLPQISTANILRPRGLLDDILNTSSDSTRGGSGGVTPIAQGLADILTGLGNTDNSSLPDTI
LSALAGRGLNDLREAIVGNVDDRIMPSLGLPQWVSLHAQTICNGNYTNPDDPHSSVRARSCTKPNTRLKNITEVL
DLNRNVEDATSLLRLPRAASEMLQLYVDMANGIIIALTTVFSLGTVCGFLTMLLTGVSFILADNRGLAIANLVLA
VFAFAFIGGGFVISAIAATVCANRANRVLEDFKVTTELGSKYLQIGIAATVLSFLVAIFWIVAFIVRFRRGAAQS
FIVKMRPRRSIEERQPMKLDNE*
Coding >Hirsu2|3275
ATGTGCAAGATCAACATCTCCAGGTTGGACATTGGCAATGGGCTGCTCCCGCAGATATCAACCGCAAACATCTTG
CGTCCGAGAGGACTACTGGATGACATCCTCAACACCAGTTCCGACAGTACCAGAGGCGGCAGCGGCGGCGTAACG
CCCATCGCGCAGGGCCTCGCCGACATCCTGACAGGGTTGGGGAATACCGATAACTCCAGCCTGCCGGACACGATT
CTCAGTGCGCTCGCGGGCCGGGGCTTGAACGACCTGCGCGAAGCCATCGTCGGCAACGTGGACGACAGGATCATG
CCCAGTCTCGGCCTCCCGCAATGGGTCTCGCTTCATGCCCAGACGATTTGCAACGGGAACTACACGAACCCCGAT
GATCCACACTCGTCCGTGCGAGCACGGTCTTGCACAAAGCCGAACACCCGCTTGAAGAACATAACAGAGGTCCTC
GATCTCAACCGCAACGTCGAAGACGCTACGTCGCTTTTGCGGCTGCCCAGGGCGGCGAGCGAAATGCTTCAGCTT
TACGTCGACATGGCCAACGGAATCATCATCGCCCTGACCACCGTCTTCTCCCTCGGCACCGTGTGCGGTTTCCTG
ACGATGCTACTCACGGGCGTCTCCTTTATCCTGGCGGACAACAGAGGCCTCGCCATTGCGAACCTCGTCCTGGCC
GTCTTCGCCTTTGCTTTCATCGGCGGCGGCTTCGTCATCTCAGCCATCGCCGCGACCGTGTGCGCAAATAGGGCC
AACAGGGTCCTCGAGGACTTCAAGGTTACCACGGAGCTGGGCTCCAAGTACTTGCAGATCGGAATCGCGGCCACC
GTGCTGTCATTCCTCGTGGCCATCTTTTGGATTGTTGCGTTCATCGTCCGCTTTCGCCGCGGCGCTGCTCAGTCG
TTTATTGTCAAGATGCGGCCGCGGAGGAGTATAGAGGAGCGTCAACCGATGAAGTTGGACAATGAGTAG
Transcript >Hirsu2|3275
ATGTGCAAGATCAACATCTCCAGGTTGGACATTGGCAATGGGCTGCTCCCGCAGATATCAACCGCAAACATCTTG
CGTCCGAGAGGACTACTGGATGACATCCTCAACACCAGTTCCGACAGTACCAGAGGCGGCAGCGGCGGCGTAACG
CCCATCGCGCAGGGCCTCGCCGACATCCTGACAGGGTTGGGGAATACCGATAACTCCAGCCTGCCGGACACGATT
CTCAGTGCGCTCGCGGGCCGGGGCTTGAACGACCTGCGCGAAGCCATCGTCGGCAACGTGGACGACAGGATCATG
CCCAGTCTCGGCCTCCCGCAATGGGTCTCGCTTCATGCCCAGACGATTTGCAACGGGAACTACACGAACCCCGAT
GATCCACACTCGTCCGTGCGAGCACGGTCTTGCACAAAGCCGAACACCCGCTTGAAGAACATAACAGAGGTCCTC
GATCTCAACCGCAACGTCGAAGACGCTACGTCGCTTTTGCGGCTGCCCAGGGCGGCGAGCGAAATGCTTCAGCTT
TACGTCGACATGGCCAACGGAATCATCATCGCCCTGACCACCGTCTTCTCCCTCGGCACCGTGTGCGGTTTCCTG
ACGATGCTACTCACGGGCGTCTCCTTTATCCTGGCGGACAACAGAGGCCTCGCCATTGCGAACCTCGTCCTGGCC
GTCTTCGCCTTTGCTTTCATCGGCGGCGGCTTCGTCATCTCAGCCATCGCCGCGACCGTGTGCGCAAATAGGGCC
AACAGGGTCCTCGAGGACTTCAAGGTTACCACGGAGCTGGGCTCCAAGTACTTGCAGATCGGAATCGCGGCCACC
GTGCTGTCATTCCTCGTGGCCATCTTTTGGATTGTTGCGTTCATCGTCCGCTTTCGCCGCGGCGCTGCTCAGTCG
TTTATTGTCAAGATGCGGCCGCGGAGGAGTATAGAGGAGCGTCAACCGATGAAGTTGGACAATGAGTAG
Gene >Hirsu2|3275
ATGTGCAAGATCAACATCTCCAGGTTGGACATTGGCAATGGGCTGCTCCCGCAGATATCAACCGCAAACATCTTG
CGTCCGAGAGGACTACTGGATGACATCCTCAACACCAGTTCCGACAGTACCAGAGGCGGCAGCGGCGGCGTAACG
CCCATCGCGCAGGGCCTCGCCGACATCCTGACAGGGTTGGGGAATACCGATAACTCCAGCCTGCCGGACACGATT
CTCAGTGCGCTCGCGGGCCGGGGCTTGAACGACCTGCGCGAAGCCATCGTCGGCAACGTGGACGACAGGATCATG
CCCAGTCTCGGCCTCCCGCAATGGGTCTCGCTTCATGCCCAGACGATTTGCAACGGGAACTACACGAACCCCGAT
GATCCACACTCGTCCGTGCGAGCACGGTCTTGCACAAAGCCGAACAGTAAGCTCCAGCCTCTCCGGACCGCGCCC
AAGTCCGAGCAAAGATGAGACGTTGACGCCGGCTCGAAACCGCCTCGCAGCCCGCTTGAAGAACATAACAGAGGT
CCTCGATCTCAACCGCAACGTCGAAGACGCTACGTCGCTTTTGCGGCTGCCCAGGGCGGCGAGCGAAATGCTTCA
GCTTTACGTCGACATGGCCAACGGAATCATCATCGCCCTGACCACCGTCTTCTCCCTCGGCACCGTGTGCGGTTT
CCTGACGATGCTACTCACGGGCGTCTCCTTTATCCTGGCGGACAACAGAGGCCTCGCCATTGCGAACCTCGTCCT
GGCCGTCTTCGCCTTTGCTTTCATCGGCGGCGGCTTCGTCATCTCAGCCATCGCCGCGACCGTGTGCGCAAATAG
GGCCAACAGGGTCCTCGAGGACTTCAAGGTTACCACGGAGCTGGGCTCCAAGTACTTGCAGATCGGAATCGCGGC
CACCGTGCTGTCATTCCTCGTGGCCATCTTTTGGATTGTTGCGTTCATCGTCCGCTTTCGCCGCGGCGCTGCTCA
GTCGTTTATTGTCAAGATGCGGCCGCGGAGGAGTATAGAGGAGCGTCAACCGATGAAGTTGGACAATGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail