Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3273
Gene name
LocationContig_184:14346..15855
Strand+
Gene length (bp)1509
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.1E-06 222 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 188 471 3.0E-11
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 213 479 3.0E-10
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 188 471 3.0E-11
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 213 479 3.0E-10
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 220 465 4.0E-06
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 220 465 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 119 137 18
2 152 174 22
3 221 243 22
4 253 272 19
5 281 300 19
6 315 337 22
7 358 380 22
8 395 417 22
9 424 446 22
10 451 473 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3273
MMDSASGGNEERAERPERAQGPDGRASTGSLTAADRPALRRNGRSGTPLLFKAEDHLDANGEAQQSLLWSGDEPA
TSIDLDAGDDADDAARRPTFSRRSTMRNRSPLAAAARASARKKYTYAAFFLAVSLVTFAIQTELSSHIQHDLGWD
KAYCMMYFTHGSWIVLWPAMLLILRLQKLDEPWPVFWRRHKQVLSSTIAMIELQTLDVFNPSAQRRARPALYLAR
TTAFITSALTIAGLSWYVAVSLTTPSDLTAIYNCSAFFAYIFSVPILHEPLRLDKSVAVFIAIVGVLVVAYGDTG
DSSGEPGSGPGNTAPGAGSRFVGNLVIGVGSVLYGLYEVLYKRYACPPEGVSPGRGTIFANTFGACIGLFTLTVL
WIPLPILHILNIERFELPDASTGWLVLVAVLANATFSGSFLVLISLTSPVLSSVAALLTIFIVALADWFLTGQPL
SWAAIIGGSMIIVAFVGLSWSTYREMAEHEARKLAVDLTDSDEDADISPGEP*
Coding >Hirsu2|3273
ATGATGGACTCTGCCAGCGGCGGCAACGAGGAGAGGGCAGAGAGGCCGGAGAGGGCACAGGGCCCCGACGGCCGG
GCCTCGACGGGCAGCCTCACTGCGGCCGACCGCCCGGCGCTCCGTCGGAATGGCCGGTCCGGCACCCCGCTGCTG
TTCAAGGCCGAGGACCACCTCGACGCCAACGGCGAGGCCCAACAGAGCCTCCTCTGGTCGGGCGACGAGCCGGCC
ACAAGCATCGATCTCGATGCCGGCGACGACGCCGACGACGCCGCCCGGCGGCCGACCTTCAGCAGGCGCTCCACC
ATGCGCAACAGAAGCCCGCTCGCGGCCGCCGCCCGGGCCTCGGCCCGCAAGAAGTACACGTACGCCGCCTTCTTC
CTCGCCGTCAGCCTCGTCACCTTCGCCATCCAGACGGAACTCAGCTCGCACATCCAGCACGACCTGGGCTGGGAC
AAGGCCTACTGCATGATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCGGCCATGCTCCTCATCCTGCGG
CTGCAGAAGCTCGACGAGCCGTGGCCCGTCTTCTGGAGGCGCCATAAGCAGGTGCTCTCCTCCACCATCGCCATG
ATCGAGCTGCAGACGCTCGACGTCTTCAACCCGTCGGCCCAGCGCCGCGCCCGGCCCGCCCTGTACCTGGCCCGC
ACCACCGCCTTCATCACCTCGGCCCTGACGATAGCCGGCCTGAGCTGGTACGTCGCCGTCAGCCTCACGACGCCC
TCGGACCTGACGGCCATCTACAACTGCTCCGCCTTCTTCGCCTACATCTTCTCCGTCCCCATCCTGCACGAGCCG
CTGCGCCTCGACAAGTCCGTCGCCGTCTTCATCGCCATCGTCGGCGTCCTGGTCGTGGCCTACGGCGACACGGGC
GACAGCTCCGGCGAGCCCGGCTCCGGCCCCGGCAACACGGCGCCGGGCGCGGGCAGCCGCTTCGTCGGCAACCTC
GTCATCGGCGTCGGCTCCGTCCTCTACGGCCTGTACGAGGTGCTCTACAAGCGCTACGCCTGCCCGCCCGAGGGC
GTCTCCCCCGGCCGCGGCACCATCTTCGCCAACACCTTCGGCGCCTGCATCGGCCTCTTCACCCTCACCGTCCTG
TGGATCCCGCTCCCCATCCTCCACATCCTCAACATCGAACGGTTCGAGCTGCCCGACGCCTCGACCGGCTGGCTC
GTCCTCGTCGCCGTGCTGGCCAACGCAACCTTTAGCGGCTCGTTCCTCGTCCTCATCTCGCTGACGTCGCCCGTG
CTGTCCTCGGTCGCCGCCCTGCTGACCATCTTCATCGTCGCCCTCGCCGACTGGTTCCTGACGGGGCAGCCGCTG
AGCTGGGCGGCCATCATCGGCGGATCCATGATCATCGTCGCCTTTGTCGGCCTGAGCTGGAGCACCTACCGCGAG
ATGGCCGAGCACGAGGCGCGCAAGCTGGCCGTCGACCTGACCGACAGCGACGAGGATGCCGACATTTCACCGGGC
GAACCCTGA
Transcript >Hirsu2|3273
ATGATGGACTCTGCCAGCGGCGGCAACGAGGAGAGGGCAGAGAGGCCGGAGAGGGCACAGGGCCCCGACGGCCGG
GCCTCGACGGGCAGCCTCACTGCGGCCGACCGCCCGGCGCTCCGTCGGAATGGCCGGTCCGGCACCCCGCTGCTG
TTCAAGGCCGAGGACCACCTCGACGCCAACGGCGAGGCCCAACAGAGCCTCCTCTGGTCGGGCGACGAGCCGGCC
ACAAGCATCGATCTCGATGCCGGCGACGACGCCGACGACGCCGCCCGGCGGCCGACCTTCAGCAGGCGCTCCACC
ATGCGCAACAGAAGCCCGCTCGCGGCCGCCGCCCGGGCCTCGGCCCGCAAGAAGTACACGTACGCCGCCTTCTTC
CTCGCCGTCAGCCTCGTCACCTTCGCCATCCAGACGGAACTCAGCTCGCACATCCAGCACGACCTGGGCTGGGAC
AAGGCCTACTGCATGATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCGGCCATGCTCCTCATCCTGCGG
CTGCAGAAGCTCGACGAGCCGTGGCCCGTCTTCTGGAGGCGCCATAAGCAGGTGCTCTCCTCCACCATCGCCATG
ATCGAGCTGCAGACGCTCGACGTCTTCAACCCGTCGGCCCAGCGCCGCGCCCGGCCCGCCCTGTACCTGGCCCGC
ACCACCGCCTTCATCACCTCGGCCCTGACGATAGCCGGCCTGAGCTGGTACGTCGCCGTCAGCCTCACGACGCCC
TCGGACCTGACGGCCATCTACAACTGCTCCGCCTTCTTCGCCTACATCTTCTCCGTCCCCATCCTGCACGAGCCG
CTGCGCCTCGACAAGTCCGTCGCCGTCTTCATCGCCATCGTCGGCGTCCTGGTCGTGGCCTACGGCGACACGGGC
GACAGCTCCGGCGAGCCCGGCTCCGGCCCCGGCAACACGGCGCCGGGCGCGGGCAGCCGCTTCGTCGGCAACCTC
GTCATCGGCGTCGGCTCCGTCCTCTACGGCCTGTACGAGGTGCTCTACAAGCGCTACGCCTGCCCGCCCGAGGGC
GTCTCCCCCGGCCGCGGCACCATCTTCGCCAACACCTTCGGCGCCTGCATCGGCCTCTTCACCCTCACCGTCCTG
TGGATCCCGCTCCCCATCCTCCACATCCTCAACATCGAACGGTTCGAGCTGCCCGACGCCTCGACCGGCTGGCTC
GTCCTCGTCGCCGTGCTGGCCAACGCAACCTTTAGCGGCTCGTTCCTCGTCCTCATCTCGCTGACGTCGCCCGTG
CTGTCCTCGGTCGCCGCCCTGCTGACCATCTTCATCGTCGCCCTCGCCGACTGGTTCCTGACGGGGCAGCCGCTG
AGCTGGGCGGCCATCATCGGCGGATCCATGATCATCGTCGCCTTTGTCGGCCTGAGCTGGAGCACCTACCGCGAG
ATGGCCGAGCACGAGGCGCGCAAGCTGGCCGTCGACCTGACCGACAGCGACGAGGATGCCGACATTTCACCGGGC
GAACCCTGA
Gene >Hirsu2|3273
ATGATGGACTCTGCCAGCGGCGGCAACGAGGAGAGGGCAGAGAGGCCGGAGAGGGCACAGGGCCCCGACGGCCGG
GCCTCGACGGGCAGCCTCACTGCGGCCGACCGCCCGGCGCTCCGTCGGAATGGCCGGTCCGGCACCCCGCTGCTG
TTCAAGGCCGAGGACCACCTCGACGCCAACGGCGAGGCCCAACAGAGCCTCCTCTGGTCGGGCGACGAGCCGGCC
ACAAGCATCGATCTCGATGCCGGCGACGACGCCGACGACGCCGCCCGGCGGCCGACCTTCAGCAGGCGCTCCACC
ATGCGCAACAGAAGCCCGCTCGCGGCCGCCGCCCGGGCCTCGGCCCGCAAGAAGTACACGTACGCCGCCTTCTTC
CTCGCCGTCAGCCTCGTCACCTTCGCCATCCAGACGGAACTCAGCTCGCACATCCAGCACGACCTGGGCTGGGAC
AAGGCCTACTGCATGATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCGGCCATGCTCCTCATCCTGCGG
CTGCAGAAGCTCGACGAGCCGTGGCCCGTCTTCTGGAGGCGCCATAAGCAGGTGCTCTCCTCCACCATCGCCATG
ATCGAGCTGCAGACGCTCGACGTCTTCAACCCGTCGGCCCAGCGCCGCGCCCGGCCCGCCCTGTACCTGGCCCGC
ACCACCGCCTTCATCACCTCGGCCCTGACGATAGCCGGCCTGAGCTGGTACGTCGCCGTCAGCCTCACGACGCCC
TCGGACCTGACGGCCATCTACAACTGCTCCGCCTTCTTCGCCTACATCTTCTCCGTCCCCATCCTGCACGAGCCG
CTGCGCCTCGACAAGTCCGTCGCCGTCTTCATCGCCATCGTCGGCGTCCTGGTCGTGGCCTACGGCGACACGGGC
GACAGCTCCGGCGAGCCCGGCTCCGGCCCCGGCAACACGGCGCCGGGCGCGGGCAGCCGCTTCGTCGGCAACCTC
GTCATCGGCGTCGGCTCCGTCCTCTACGGCCTGTACGAGGTGCTCTACAAGCGCTACGCCTGCCCGCCCGAGGGC
GTCTCCCCCGGCCGCGGCACCATCTTCGCCAACACCTTCGGCGCCTGCATCGGCCTCTTCACCCTCACCGTCCTG
TGGATCCCGCTCCCCATCCTCCACATCCTCAACATCGAACGGTTCGAGCTGCCCGACGCCTCGACCGGCTGGCTC
GTCCTCGTCGCCGTGCTGGCCAACGCAACCTTTAGCGGCTCGTTCCTCGTCCTCATCTCGCTGACGTCGCCCGTG
CTGTCCTCGGTCGCCGCCCTGCTGACCATCTTCATCGTCGCCCTCGCCGACTGGTTCCTGACGGGGCAGCCGCTG
AGCTGGGCGGCCATCATCGGCGGATCCATGATCATCGTCGCCTTTGTCGGCCTGAGCTGGAGCACCTACCGCGAG
ATGGCCGAGCACGAGGCGCGCAAGCTGGCCGTCGACCTGACCGACAGCGACGAGGATGCCGACATTTCACCGGGC
GAACCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail