Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3267
Gene name
LocationContig_184:2852..3819
Strand+
Gene length (bp)967
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 DUF3328 Domain of unknown function (DUF3328) 8.8E-44 24 227

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0044550 secondary metabolite biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0009058 biosynthetic process No
GO:0019748 secondary metabolic process No
GO:0009403 toxin biosynthetic process No
GO:0009404 toxin metabolic process No
GO:0043385 mycotoxin metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3267
MARPPLYSKLRSGPEDEEQASTGPRRAVADRRTLLIAALVLCNLASLALLCFRSGAADCVRPRLITTPALEAIRY
ERKTLWRSIVNNSFTGEPRPELDAAWARLLEPITVKISAAELAAHGGDSIAFRDGSGFLAEPAVYHELHCIKRIR
QHLHPAYYHPSGLSPLEQRLEGPHIDHCLEYLREAAMCRGDTALALFRWGKGKPYSTVESTHECVDWDRLDGWAR
GRAVDLRDLGVLVAEEEHV*
Coding >Hirsu2|3267
ATGGCCCGCCCGCCGCTCTACAGCAAGCTAAGGTCCGGACCGGAGGACGAGGAGCAGGCGTCGACGGGGCCGCGG
CGCGCCGTCGCCGACCGACGGACTCTGCTGATCGCCGCTCTCGTCCTCTGCAACCTCGCCAGCCTGGCGCTGCTG
TGCTTCCGCAGCGGCGCCGCCGACTGCGTCCGCCCCAGGCTCATCACCACGCCGGCCCTCGAGGCCATCCGCTAC
GAGCGCAAGACGCTGTGGCGCAGCATCGTCAACAACAGCTTCACGGGCGAGCCCCGGCCCGAGCTGGACGCCGCG
TGGGCACGCCTGCTGGAGCCCATCACCGTCAAGATCTCGGCGGCCGAGCTGGCGGCCCACGGCGGCGACTCCATC
GCCTTCCGGGACGGGTCCGGCTTCCTGGCCGAGCCGGCCGTGTATCACGAGCTTCACTGCATTAAACGCATCCGC
CAGCACTTACACCCGGCCTACTACCACCCGAGCGGCCTCTCGCCGCTCGAGCAGCGGCTGGAAGGCCCGCACATC
GACCACTGCCTCGAGTACCTCCGCGAGGCCGCCATGTGCCGCGGCGACACCGCCCTCGCCCTGTTCCGGTGGGGG
AAGGGCAAGCCGTATTCGACGGTCGAGAGCACGCACGAGTGCGTCGACTGGGACCGCCTCGACGGCTGGGCTCGA
GGGCGGGCAGTCGACTTGCGAGACCTCGGCGTGCTGGTCGCGGAAGAGGAGCACGTCTAG
Transcript >Hirsu2|3267
ATGGCCCGCCCGCCGCTCTACAGCAAGCTAAGGTCCGGACCGGAGGACGAGGAGCAGGCGTCGACGGGGCCGCGG
CGCGCCGTCGCCGACCGACGGACTCTGCTGATCGCCGCTCTCGTCCTCTGCAACCTCGCCAGCCTGGCGCTGCTG
TGCTTCCGCAGCGGCGCCGCCGACTGCGTCCGCCCCAGGCTCATCACCACGCCGGCCCTCGAGGCCATCCGCTAC
GAGCGCAAGACGCTGTGGCGCAGCATCGTCAACAACAGCTTCACGGGCGAGCCCCGGCCCGAGCTGGACGCCGCG
TGGGCACGCCTGCTGGAGCCCATCACCGTCAAGATCTCGGCGGCCGAGCTGGCGGCCCACGGCGGCGACTCCATC
GCCTTCCGGGACGGGTCCGGCTTCCTGGCCGAGCCGGCCGTGTATCACGAGCTTCACTGCATTAAACGCATCCGC
CAGCACTTACACCCGGCCTACTACCACCCGAGCGGCCTCTCGCCGCTCGAGCAGCGGCTGGAAGGCCCGCACATC
GACCACTGCCTCGAGTACCTCCGCGAGGCCGCCATGTGCCGCGGCGACACCGCCCTCGCCCTGTTCCGGTGGGGG
AAGGGCAAGCCGTATTCGACGGTCGAGAGCACGCACGAGTGCGTCGACTGGGACCGCCTCGACGGCTGGGCTCGA
GGGCGGGCAGTCGACTTGCGAGACCTCGGCGTGCTGGTCGCGGAAGAGGAGCACGTCTAG
Gene >Hirsu2|3267
ATGGCCCGCCCGCCGCTCTACAGCAAGCTAAGGTCCGGACCGGAGGACGAGGAGCAGGCGTCGACGGGGCCGCGG
CGCGCCGTCGCCGACCGACGGACTCTGCTGATCGCCGCTCTCGTCCTCTGCAACCTCGCCAGCCTGGCGCTGCTG
TGCTTCCGCAGCGGCGCCGCCGACTGCGTCCGCCCCAGGCTCATCACCAGTACGAAGTCCACGAACCGCTTCTCA
CACGGGGGAGCCGTGGATGGGGAGCATGTATCTGACGAGCACCTCGCACAGCGCCGGCCCTCGAGGCCATCCGCT
ACGAGCGCAAGACGCTGTGGCGCAGCATCGTCAACAACAGCTTCACGGGCGAGCCCCGGCCCGAGCTGGACGCCG
CGTGGGCACGCCTGCTGGAGCGTACGTATGAGACGAGTCCCTTGCTCGGCTTTTGCCCTGACGCCTCTCTTCGTG
GCAGCCATCACCGTCAAGATCTCGGCGGCCGAGCTGGCGGCCCACGGCGGCGACTCCATCGCCTTCCGGGACGGG
TCCGGCTTCCTGGCCGAGCCGGCCGTGTATCACGAGCTTCACTGCATTGTACGTAGGAGCCCGCCCCATCGGACC
TCTTTTGCCGTAGGCCCTTCGTCCCGCCTGTGAGCTTTGTCTGACGTCGGCAACGACAATGTGAGGACAGAAACG
CATCCGCCAGCACTTACACCCGGCCTACTACCACCCGAGCGGCCTCTCGCCGCTCGAGCAGCGGCTGGAAGGCCC
GCACATCGACCACTGCCTCGAGTACCTCCGCGAGGCCGCCATGTGCCGCGGCGACACCGCCCTCGCCCTGTTCCG
GTGGGGGAAGGGCAAGCCGTATTCGACGGTCGAGAGCACGCACGAGTGCGTCGACTGGGACCGCCTCGACGGCTG
GGCTCGAGGGCGGGCAGTCGACTTGCGAGACCTCGGCGTGCTGGTCGCGGAAGAGGAGCACGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail